CAZyme Information: PTTG_06042-t43_1-p1

Basic Information

• Species: Puccinia triticina
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia triticina
• CAZyme ID: PTTG_06042-t43_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
571		63941.59	9.0112

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ptriticina1-1BBBDRace1	15692	630390	814	14878

• Gene Location: location=ADAS02000018.1:274563-276738(+)

Full Sequence      

MTSLYHQLPLPVSLILIISSISTAVYINLFLSRFILQSYSGLLRRRNLKNRARLLALIGI
KDDKNSTKKLIVGFLHPYCNAGGGGERVLWTAVALHQRTEPDTICAIYTGDLGVSKHDII
EKVKSRFGIILDPAALLLVPLKTRYLVEASTWPRFTLLGQSLGSLVLGHEALSALIPDIY
IDTMGYAFTFPVFRLLTDVPIGAYIHYPTISNDMLKRVSSRNSAHNNSSTISNSLALSYA
KLVYYIIFAELYSLCLRQAHHLMVNSSWTKNHIDRLLKPWIYRHEEDAEETEETAKDWTR
SSNPPQSCESQKLDGLRLRIPASDPSAENGQNKTINIPTKKRKFDQATVVYPPCDVQSFV
DFPISPRTSTILSISQFRPEKDQATQIAAFARFFSSLEADDPRRTEIKLVLAGSCRDDAD
QKRVDQLKQLAQQLGLAGAVEFRVNISWDQLKDLLRNSLVGISTMVDEHFGISIVEFMAS
GMIPLVHRSAGPLLDIVVPLAQDSSQEGETCTGFHADGVAEYAKQLNHIFLSLNAVERAK
IQAAARQLALRKFGVAQFELAWITSFRQIRR

Enzyme Prediction     

EC	2.4.1.131:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	366	527	1.2e-22	0.86875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340835	GT4_ALG11-like	0.0	70	559	1	417	alpha-1,2-mannosyltransferase ALG11 and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. ALG11 in yeast is involved in adding the final 1,2-linked Man to the Man5GlcNAc2-PP-Dol synthesized on the cytosolic face of the ER. The deletion analysis of ALG11 was shown to block the early steps of core biosynthesis that takes place on the cytoplasmic face of the ER and lead to a defect in the assembly of lipid-linked oligosaccharides.
215511	PLN02949	5.86e-159	24	569	11	457	transferase, transferring glycosyl groups
406369	ALG11_N	4.02e-135	70	276	1	207	ALG11 mannosyltransferase N-terminus.
395425	Glycos_transf_1	1.58e-18	371	547	5	157	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
340831	GT4_PimA-like	6.68e-18	345	557	164	356	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CRX79053.1|GT4	7.92e-150	36	570	41	597
CDR44337.1|GT4	6.42e-122	42	569	29	557
QRW21356.1|GT4	7.75e-122	30	571	243	712
BAP28176.1|GT4	5.46e-113	60	569	53	490
BAE34179.1|GT4	5.46e-113	60	569	53	490

PDB Hits     

PTTG_06042-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q3TZM9|ALG11_MOUSE	9.69e-114	60	569	53	490	GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Mus musculus OX=10090 GN=Alg11 PE=2 SV=1
sp|Q2TAA5|ALG11_HUMAN	6.04e-112	60	569	53	490	GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Homo sapiens OX=9606 GN=ALG11 PE=1 SV=2
sp|Q5R7Z6|ALG11_PONAB	2.39e-111	60	569	53	490	GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Pongo abelii OX=9601 GN=ALG11 PE=2 SV=2
sp|Q08B22|ALG11_XENLA	2.47e-109	60	565	49	480	GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Xenopus laevis OX=8355 GN=alg11 PE=2 SV=2
sp|Q7ZW24|ALG11_DANRE	2.58e-106	72	569	63	494	GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Danio rerio OX=7955 GN=alg11 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000057	0.000010

TMHMM  Annotations     

Start	End
13	35