CAZyme Information: PTTG_05992-t43_1-p1

Basic Information

• Species: Puccinia triticina
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia triticina
• CAZyme ID: PTTG_05992-t43_1-p1
• CAZy Family: GH47
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
468		50231.63	5.6386

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ptriticina1-1BBBDRace1	15692	630390	814	14878

• Gene Location: location=ADAS02000128.1:151561-153300(-)

Full Sequence      

MFSIARLTRFLALSLPLTEAASLNVNDLSALKNAASAALKNLMSFYTPNPSGVFDQAQTP
WHESGMIWGLFMDYAKYTGDTQFLDVVTGALVNTSYGPEQDLLGGAMSSTAATLLGRWND
DILWHSLATIGGAEIYGADSIMPGSKGPWITLAQKTYDQTYQQWDGGCGGGIYWSRDRNG
ASAPYKSLITQLEFIQQGARNFMENKNNTALDLSKAAMDWVFSSGLGNVQTGVLYDGMNV
GECGKFTTHLWSYNYGSLLGALAWMHKATGNNTYLDLIAPFYNYAQLTFSGQNVSNVVTE
TCEPGAKCNRDQQGFKAIYLRNLAYTYRETTSDQVKGAIKSTIDASVAAMVQYSCDNDWF
CNGNWTADASPVKYVRSQHVAAALLVSALGVHLSPEGGLLPKITPGQLTDTTNGAAGLGS
GGTKNPGKVTSKPLGAASGLQVTFSTLFLGLFIVAFSTSTFDPLALIP

Enzyme Prediction     

No EC number prediction in PTTG_05992-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	27	375	2.9e-52	0.8910614525139665

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	9.77e-51	31	368	2	333	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALL41171.1|GH76	1.29e-235	11	457	16	465
ALL41020.1|GH76	3.10e-170	1	402	1	405
ALL41366.1|GH76	1.47e-115	142	416	1	275
CAC10089.2|GH76	4.76e-39	5	451	13	458
EAA35418.3|GH76	4.76e-39	5	451	13	458

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	9.56e-18	41	351	46	361	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q75DG6|DCW1_ASHGO	3.28e-26	22	363	23	366	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|Q05031|DFG5_YEAST	1.35e-21	18	395	24	397	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DFG5 PE=1 SV=1
sp|Q5ACZ2|DFG5_CANAL	3.90e-16	19	389	20	388	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DFG5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.003848	0.996104	CS pos: 20-21. Pr: 0.9600

TMHMM  Annotations     

There is no transmembrane helices in PTTG_05992-t43_1-p1.