CAZyme Information: PTTG_05886-t43_1-p1

Basic Information

• Species: Puccinia triticina
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia triticina
• CAZyme ID: PTTG_05886-t43_1-p1
• CAZy Family: GH43
• CAZyme Description: hypothetical protein, variant

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
381		43099.49	7.1532

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ptriticina1-1BBBDRace1	15692	630390	814	14878

• Gene Location: location=ADAS02000014.1:982941-984574(-)

Full Sequence      

MVQNPPAIPTLPIVQLSRLMIGSKLIIDWHNTAYSILALKFRTERHPMVRLAKWIEAKFG
KHATLHLFVTEAEKQALSEMWNLRGSKKVFYDRPPKSFCRLTVPEIHSFLSQSSFNYNSV
LQQMFIGGELEKETILSYEDPETKTAKMKADRPALVVSSTSWTIDEDFSVLIDALSMYAR
SKKSQKSIPKLLCLITGKGPLKAHYLEIIERTSSEEGWKELGIVCQSVWFDDPEHYRQLL
GAADLGISLHQSSSGLDLPMKVVDMFGCRLPVCARNFNCISELVKHGQNGLVFDSAVELS
EQLKELLTGFNPARSMKELASSNSNSRTLKDLQTGIENAMYGAVLSTNDKDLDRLQSSGC
RSWSCWEEEWNQQVFQTVQNL

Enzyme Prediction     

EC	2.4.1.142:10	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT33	1	327	1.5e-110	0.72

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340843	GT33_ALG1-like	2.21e-128	1	327	99	398	chitobiosyldiphosphodolichol beta-mannosyltransferase and similar proteins. This family is most closely related to the GT33 family of glycosyltransferases. The yeast gene ALG1 has been shown to function as a mannosyltransferase that catalyzes the formation of dolichol pyrophosphate (Dol-PP)-GlcNAc2Man from GDP-Man and Dol-PP-Glc-NAc2, and participates in the formation of the lipid-linked precursor oligosaccharide for N-glycosylation. In humans ALG1 has been associated with the congenital disorders of glycosylation (CDG) designated as subtype CDG-Ik.
215155	PLN02275	3.06e-102	1	307	105	371	transferase, transferring glycosyl groups
340831	GT4_PimA-like	2.57e-09	7	320	90	341	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
223515	RfaB	9.01e-08	149	320	195	353	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
340839	GT4_GT28_WabH-like	2.64e-07	167	324	202	343	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV76128.1|GT33	4.80e-93	1	371	45	400
CED84249.1|GT33	6.64e-86	2	310	151	473
QRW18978.1|GT33	2.53e-84	1	322	72	374
KGB75402.1|GT33	1.34e-83	1	380	147	502
UOH79650.1|GT33	1.42e-83	1	380	50	405

PDB Hits     

PTTG_05886-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q921Q3|ALG1_MOUSE	1.66e-74	3	318	130	436	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Mus musculus OX=10090 GN=Alg1 PE=1 SV=3
sp|Q5R7A2|ALG1_PONAB	9.76e-72	3	318	130	436	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Pongo abelii OX=9601 GN=ALG1 PE=2 SV=1
sp|Q9BT22|ALG1_HUMAN	1.07e-70	3	318	130	436	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Homo sapiens OX=9606 GN=ALG1 PE=1 SV=2
sp|Q8L7M0|TUN_ARATH	1.53e-66	1	310	105	420	UDP-glycosyltransferase TURAN OS=Arabidopsis thaliana OX=3702 GN=TUN PE=2 SV=1
sp|P90522|ALG1_DICDI	6.79e-64	1	308	111	416	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Dictyostelium discoideum OX=44689 GN=alg1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999865	0.000161

TMHMM  Annotations     

There is no transmembrane helices in PTTG_05886-t43_1-p1.