CAZyme Information: PTTG_05423-t43_1-p1

Basic Information

• Species: Puccinia triticina
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia triticina
• CAZyme ID: PTTG_05423-t43_1-p1
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
689		77706.98	7.9439

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ptriticina1-1BBBDRace1	15692	630390	814	14878

• Gene Location: location=ADAS02000029.1:135647-138307(-)

Full Sequence      

MAGLRRLLLFTILLLSLTTLLIFYSTTTTPNNASLAIQDRIQNGLKGYLPNRETLKTYVP
KPFKWSNWATSDAVRLEDSLIPTHQQQPHLNQSAQTISSHPSGQAAQPLSNYHPNGLYYL
NQPPPFERHPILNLIENGEKAWAKKLAGSSQSLAEAVAEYRRRYHQPPPFGFEKWWEYAA
KEGVILKDEYDQIASDIKPFLAIEPSDLHHRAWVMANERPETFTLTINSTNPVQISGKEG
HLARAKDLAKLINLFAHLLPPSSSDPANIFNLTFTKHDQPAVQMTWARKQKMIEMADAGE
YFSPSDYIRPTNPKLSNWANACPPSSALYRNESGLPPLDAAEARMSSAGGGKSFIFDHPK
AMEICAHPESMKLHGFTSAAGTDNVELVPLFTFAKTTTQSDVLVTPLEQYSDTYIGNDPD
WAQKKIAKLLWRGSTTGAEFRTDVNWKDSQRARLHIMAHEANHPVHILSPDDSLTRVATK
DIGKLNEKLLDVSLSGGPVQCDPTTCEYMAKNLKFAGTMGLDESYQYKYLIDVDGNGWSG
RYHRLMSTKSLVLKSTIFPEWYSDRIQPWVHYVPIKVDYSDLYDVMVFFKGDDDEENAGP
SPPPTKPDGPRIPQHSRTTREARTDRARRAPVGTSKGHDHLAEKIATQGKRWAAEHWRRT
DMAAYMFRLVLEWRRVLLRGTGEPLDYLG

Enzyme Prediction     

No EC number prediction in PTTG_05423-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	385	677	2.1e-65	0.904

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	2.97e-17	376	678	19	254	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	2.92e-09	526	677	215	323	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR40950.1|GT90	4.79e-189	101	687	150	702
CDR40723.1|GT90	8.74e-165	101	688	184	715
CDR48932.1|GT90	4.07e-117	125	688	167	695
CDR40913.1|GT90	4.58e-114	128	689	241	754
CDR40393.1|GT90	3.19e-111	129	687	114	642

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	3.54e-07	388	594	117	305	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	6.92e-91	129	688	152	668	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|Q7Z4H8|PLGT3_HUMAN	3.04e-08	471	595	317	436	Protein O-glucosyltransferase 3 OS=Homo sapiens OX=9606 GN=POGLUT3 PE=1 SV=2
sp|G3V9D0|PGLT1_RAT	5.28e-08	388	687	145	380	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|Q566E5|PLGT3_RAT	7.00e-08	482	595	329	437	Protein O-glucosyltransferase 3 OS=Rattus norvegicus OX=10116 GN=Poglut3 PE=2 SV=1
sp|Q197C5|VF179_IIV3	2.30e-07	421	593	305	455	Uncharacterized protein 035R OS=Invertebrate iridescent virus 3 OX=345201 GN=IIV3-035R PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.987799	0.012205

TMHMM  Annotations     

Start	End
7	29