CAZyme Information: PTTG_05386-t43_1-p1

Basic Information

• Species: Puccinia triticina
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia triticina
• CAZyme ID: PTTG_05386-t43_1-p1
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
425		46093.52	6.2301

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ptriticina1-1BBBDRace1	15692	630390	814	14878

• Gene Location: location=ADAS02000014.1:91348-92786(+)

Full Sequence      

MKVGIAAASLLILWTSFARVDSQSASKSTPEPNLPLHFEKCTPDHGCKKVPGGITLDANW
RAVKDSASGRKDCLNGNGTKGWDKTLCPDPETCAQNCALDSIDYHKQRISTNGRDGNHDS
VTLKLFKEDARNTGSRIYLLDASHQRYEMFFLLNQELSFDVDVSQSSCGVASGIYFSAMP
ADGGMSSTNQAGAKYGTGYCDAQGPRDMHFVDGKANLAVGSGGGDEVGYACPELDVWEAN
RISQAYTVHNCQDEQARLCHGAKCGGLCDGSGCDYASFRMGNTSFYGPSKIVDTAKKFTV
VTQFITADNTDRGELVEIRRFYRQDGRLIPNSRVNLPNASPFDSITDEFCQQMESVVGHA
KGFRTLGGLRKMGASMRNGMVLVMTVWADQVRGMSWLDGQNPDKNDAGVEFSNIRVGPIG
STSEP

Enzyme Prediction     

EC	3.2.1.176:83	3.2.1.132:6	3.2.1.4:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH7	26	423	2.5e-131	0.9903614457831326

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395677	Glyco_hydro_7	0.0	27	422	3	434	Glycosyl hydrolase family 7.
153432	GH7_CBH_EG	2.89e-143	30	417	1	386	Glycosyl hydrolase family 7. Glycosyl hydrolase family 7 contains eukaryotic endoglucanases (EGs) and cellobiohydrolases (CBHs) that hydrolyze glycosidic bonds using a double-displacement mechanism. This leads to a net retention of the conformation at the anomeric carbon. Both enzymes work synergistically in the degradation of cellulose,which is the main component of plant cell wall, and is composed of beta-1,4 linked glycosyl units. EG cleaves the beta-1,4 linkages of cellulose and CBH cleaves off cellobiose disaccharide units from the reducing end of the chain. In general, the O-glycosyl hydrolases are a widespread group of enzymes that hydrolyze the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycoside hydrolase family 7.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV83336.1|CBM1|GH7	3.25e-122	7	422	4	448
QRW12072.1|CBM1|GH7	1.30e-121	7	422	4	448
QRW07436.1|CBM1|GH7	4.29e-120	1	422	1	448
QRV78504.1|CBM1|GH7	4.29e-120	1	422	1	448
QRV97539.1|CBM1|GH7	3.33e-119	1	422	1	448

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XSP_A	1.35e-113	29	422	7	437	Structure of Cellobiohydrolase 1 (Cel7A) from Heterobasidion annosum [Heterobasidion annosum],2YG1_A APO STRUCTURE OF CELLOBIOHYDROLASE 1 (CEL7A) FROM HETEROBASIDION ANNOSUM [Heterobasidion annosum],2YG1_B APO STRUCTURE OF CELLOBIOHYDROLASE 1 (CEL7A) FROM HETEROBASIDION ANNOSUM [Heterobasidion annosum]
1Q9H_A	2.46e-113	25	422	3	433	Chain A, cellobiohydrolase I catalytic domain [Rasamsonia emersonii],3PFJ_A Chain A, Cellobiohydrolase 1 catalytic domain [Rasamsonia emersonii],3PFX_A Chain A, Cellobiohydrolase 1 catalytic domain [Rasamsonia emersonii],3PFZ_A Chain A, Cellobiohydrolase 1 catalytic domain [Rasamsonia emersonii],3PL3_A Chain A, Cellobiohydrolase 1 catalytic domain [Rasamsonia emersonii]
1GPI_A	1.15e-112	25	422	3	426	Chain A, EXOGLUCANASE I [Phanerodontia chrysosporium],1H46_X Chain X, EXOGLUCANASE I [Phanerodontia chrysosporium],1Z3T_A Chain A, cellulase [Phanerodontia chrysosporium],1Z3V_A Chain A, cellulase [Phanerodontia chrysosporium],1Z3W_A Chain A, cellulase [Phanerodontia chrysosporium]
4V1Z_A	6.39e-106	28	422	6	436	The 3-D structure of the cellobiohydrolase, Cel7A, from Aspergillus fumigatus [Aspergillus fumigatus],4V20_A The 3-D structure of the cellobiohydrolase, Cel7A, from Aspergillus fumigatus, disaccharide complex [Aspergillus fumigatus]
4XNN_A	4.74e-104	26	422	5	444	Chain A, Cellobiohydrolase CHBI [Daphnia pulex],4XNN_B Chain B, Cellobiohydrolase CHBI [Daphnia pulex],5MCC_A Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 1.11 MGy [Daphnia pulex],5MCC_B Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 1.11 MGy [Daphnia pulex],5MCD_A Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 3.27 MGy [Daphnia pulex],5MCD_B Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 3.27 MGy [Daphnia pulex],5MCE_A Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 5.43 MGy [Daphnia pulex],5MCE_B Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 5.43 MGy [Daphnia pulex],5MCF_A Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 7.59 MGy [Daphnia pulex],5MCF_B Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 7.59 MGy [Daphnia pulex],5MCH_A Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 9.75 MGy [Daphnia pulex],5MCH_B Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 9.75 MGy [Daphnia pulex],5MCI_A Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 11.9 MGy [Daphnia pulex],5MCI_B Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 11.9 MGy [Daphnia pulex],5MCJ_A Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 14.1 MGy [Daphnia pulex],5MCJ_B Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 14.1 MGy [Daphnia pulex],5MCK_A Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 16.2 MGy [Daphnia pulex],5MCK_B Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 16.2 MGy [Daphnia pulex],5MCL_A Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 18.4 MGy [Daphnia pulex],5MCL_B Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 18.4 MGy [Daphnia pulex],5MCM_A Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 20.6 MGy [Daphnia pulex],5MCM_B Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 20.6 MGy [Daphnia pulex],5MCN_A Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 22.7 MGy [Daphnia pulex],5MCN_B Radiation damage to GH7 Family Cellobiohydrolase from Daphnia pulex: Dose (DWD) 22.7 MGy [Daphnia pulex]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P13860|GUX1_PHACH	7.08e-112	11	422	7	444	Exoglucanase 1 OS=Phanerodontia chrysosporium OX=2822231 GN=CBH1 PE=2 SV=1
sp|Q92400|GUX2_AGABI	2.96e-111	9	422	5	449	Exoglucanase OS=Agaricus bisporus OX=5341 GN=cel2 PE=2 SV=1
sp|Q5B2Q4|CBHA_EMENI	3.04e-110	22	422	17	445	Probable 1,4-beta-D-glucan cellobiohydrolase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cbhA PE=2 SV=1
sp|Q4WNA2|CBHA_ASPFU	3.66e-110	21	424	16	451	Probable 1,4-beta-D-glucan cellobiohydrolase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=cbhA PE=3 SV=1
sp|B0Y793|CBHA_ASPFC	3.66e-110	21	424	16	451	Probable 1,4-beta-D-glucan cellobiohydrolase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=cbhA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000318	0.999656	CS pos: 22-23. Pr: 0.8835

TMHMM  Annotations     

There is no transmembrane helices in PTTG_05386-t43_1-p1.