CAZyme Information: PTTG_04613-t43_1-p1

Basic Information

• Species: Puccinia triticina
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia triticina
• CAZyme ID: PTTG_04613-t43_1-p1
• CAZy Family: GH27
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
342		37472.82	9.3549

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ptriticina1-1BBBDRace1	15692	630390	814	14878

• Gene Location: location=ADAS02000548.1:9648-11244(-)

Full Sequence      

MLAGNMQRAILMAIFLFATFSLAAPADESKAEGTELGQLSNEANPAGSGSGAPQRVFDFK
ITPDMKTEDLDNPKSALSKLISFIVKGASKASRYVAIVGPKTPTPEIKLRILDNSIFVPG
GGPPQLGFRRTDVNPAIDKTTTLSGITTWYQTIRLASDAPLSLEHGYLLASIEGPTGDHV
FDIFCGSDFDAKNYEHKPSSNSKTIRVRDWSTKTLLELPLVYDQNYNFAITVDWDKNTLT
VYSSTGTDPLKMASGPMANDPKAMSPDVRQKGEYHIQLIKFPLADKKTPADKVGDVPHFG
FQPPIKREHVFFSNVFVTSGKEIEQPKFTAPKTKKVKACKRT

Enzyme Prediction     

No EC number prediction in PTTG_04613-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH131	57	321	4.7e-30	0.9568627450980393

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408085	GH131_N	5.10e-54	56	317	2	245	Glycoside hydrolase 131 catalytic N-terminal domain. This is the N-terminal domain found in glycoside hydrolase family 131 (GH131A) protein observed in Coprinopsis cinerea. GH131A exhibits bifunctional exo-beta-1,3-/-1,6- and endo-beta-1,4 activity toward beta-glucan. This domain is catalytic in nature though the catalytic mechanism of C. cinerea GH131A is different from that of typical glycosidases that use a pair of carboxylic acid residues as the catalytic residues. In the case of GH131A, Glu98 and His218 may form a catalytic dyad and Glu98 may activate His218 during catalysis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALL40783.1|GH131	1.07e-47	56	302	27	276
QRV95300.1|GH131	7.93e-37	56	319	22	296
QRW09714.1|GH131	3.03e-36	83	319	45	296
QRV80910.1|GH131	3.03e-36	83	319	45	296
QRW22550.1|GH131	1.11e-35	83	319	45	294

PDB Hits     

PTTG_04613-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

PTTG_04613-t43_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000236	0.999738	CS pos: 23-24. Pr: 0.9828

TMHMM  Annotations     

There is no transmembrane helices in PTTG_04613-t43_1-p1.