CAZyme Information: PTTG_04578-t43_1-p1

Basic Information

• Species: Puccinia triticina
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia triticina
• CAZyme ID: PTTG_04578-t43_1-p1
• CAZy Family: GH26
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
398		44821.65	10.8190

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ptriticina1-1BBBDRace1	15692	630390	814	14878

• Gene Location: location=ADAS02000003.1:861894-863211(-)

Full Sequence      

MLLLLPTILLARGVSLLLLASTALRPFDHSAAIRHPRHAQLVRWDALHFRSPSPRREQDW
AFARAIALQKHCPPLPASILAALASTAATLILFRLTLQLSRSPRHATLVALLHAFAPAPA
TQVVPYTEPFYALFSFAALDLHHRRPSAGLPVALLAAAATALRPLGTLQALIWLPDALLH
LARFRAAPLSPTSVARLAKHALRILALALITAAPFLYDQYAAYTLFCRHPAPADNRPWCA
NPIPSIYLFVQAHYWNNGFLNYWTWNQAPLFLLSLPVYWASFGGIWAYYRHFLAIRGQPR
SKAEGAHPTERPFLSPHIHIHVLIQLILTTTLLLCSHVQIILRQAATIPAFWWGLADGIQ
RHWDHPHSPHNYWRLWLPWIVVWTPISLLLWAGFYPPA

Enzyme Prediction     

No EC number prediction in PTTG_04578-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	38	398	2.9e-67	0.8771498771498771

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	1.51e-27	91	398	128	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	1.47e-04	168	294	206	329	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CED83330.1|GT76	4.94e-38	88	398	86	422
KGB77682.1|GT76	9.59e-37	21	398	29	423
EAL22094.1|GT76	9.59e-37	21	398	29	423
AAW42711.1|GT76	2.56e-36	21	398	29	423
AFR93820.1|GT76	3.37e-36	21	398	29	420

PDB Hits     

PTTG_04578-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0CP63|GPI18_CRYNB	1.70e-37	21	398	29	423	GPI mannosyltransferase 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=GPI18 PE=3 SV=1
sp|P0CP62|GPI18_CRYNJ	4.54e-37	21	398	29	423	GPI mannosyltransferase 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=GPI18 PE=3 SV=1
sp|Q4WQ21|GPI18_ASPFU	2.11e-29	33	398	76	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	2.10e-28	16	398	18	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1
sp|Q2UJS7|GPI18_ASPOR	6.10e-25	21	277	48	326	GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.730895	0.269090

TMHMM  Annotations     

Start	End
2	24
75	97
204	226
267	289
320	342
372	394