CAZyme Information: PTTG_04509-t43_1-p1

Basic Information

• Species: Puccinia triticina
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia triticina
• CAZyme ID: PTTG_04509-t43_1-p1
• CAZy Family: GH26
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
326		36912.44	9.6163

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ptriticina1-1BBBDRace1	15692	630390	814	14878

• Gene Location: location=ADAS02000003.1:1415441-1417650(+)

Full Sequence      

MKTSSNRMILTKLRQKRSATLVDSLDTLFIMGLRDEFDKGVLNTLKIDFSRSQTNDSAYE
LSGSKNVALLIQARALGDKLLIAWPDHRQNLPFPQLDFRRSKPSFKKKASDVEVVIAEPV
HFLKAGTLILEFERLSYYTQDPKYLRQAIKAMQAIMNTPSTFPGLAGFFLAVQNQEVKND
LATWGVFPLPKEESVVCSLISVVLLYKRTATGLGPETFNFLGPNGEKPPQKPSLKDLEFF
KKNGFYIGFKSYELRPEVVESAFYAWRLTGDTRYQDFVWDAFKSLQKHCKAPASFSAISD
VNSLPANATNSSESFLYAELFKVEWV

Enzyme Prediction     

No EC number prediction in PTTG_04509-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	15	185	3.5e-24	0.3968609865470852

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	5.49e-64	18	322	34	425	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	2.81e-46	19	322	112	490	glycoside hydrolase family 47 protein; Provisional
224250	YyaL	0.001	57	174	479	587	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV76191.1|GH47	2.15e-43	19	322	35	430
QRW05096.1|GH47	5.79e-43	19	322	35	430
QRW21492.1|GH47	8.17e-43	19	322	74	462
QRV91005.1|GH47	3.00e-42	19	322	35	430
AME15770.1|GH47	7.15e-41	19	322	82	474

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2RI8_A	1.53e-22	19	326	46	444	Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI8_B Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI9_A Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum],2RI9_B Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum]
1KKT_A	1.80e-22	19	326	81	479	Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KKT_B Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KRE_A Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRE_B Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_A Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_B Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum]
1HCU_A	1.22e-20	19	326	56	463	Chain A, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_B Chain B, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_C Chain C, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_D Chain D, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei]
5KKB_A	2.51e-14	17	322	64	439	Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus],5KKB_B Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus]
1NXC_A	2.55e-14	17	322	62	437	Structure of mouse Golgi alpha-1,2-mannosidase IA reveals the molecular basis for substrate specificity among Class I enzymes (family 47 glycosidases) [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|E9CXX8|MNS1B_COCPS	7.17e-24	19	326	86	484	Mannosyl-oligosaccharide alpha-1,2-mannosidase OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) OX=443226 GN=CPSG_02648 PE=1 SV=1
sp|D4AV26|MNS1B_ARTBC	9.29e-24	19	326	81	478	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase ARB_00035 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_00035 PE=1 SV=1
sp|Q5BF93|MNS1B_EMENI	4.24e-23	133	326	274	472	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mns1B PE=2 SV=2
sp|A2QAS2|MNS1B_ASPNC	5.97e-23	19	326	83	481	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mns1B PE=3 SV=1
sp|Q12563|MNS1B_ASPPH	1.50e-22	19	326	83	481	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus phoenicis OX=5063 GN=mns1B PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PTTG_04509-t43_1-p1.