CAZyme Information: PTTG_02854-t43_1-p1

Basic Information

• Species: Puccinia triticina
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia triticina
• CAZyme ID: PTTG_02854-t43_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
404	ADAS02000056.1|CGC1	44698.44	5.8907

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ptriticina1-1BBBDRace1	15692	630390	814	14878

• Gene Location: location=ADAS02000056.1:570658-572585(+)

Full Sequence      

MLPYFSTILTTISLLSSAKSDAFGDKTLYPSPPPMNIQGNVIIGYYQASRGLYQQLESVP
WKYYNNGYMVFQGVWPIEQFRFTFGSEDENTLAVQNMEPFVQAATRNQVTPLLGIGGEQG
SKLFSYYMGSGGSRTTFVRAVVDLAKLYNFQGVVVTWLSPNDRGAGCNNRSPEDVVNFGY
FAQEFKKIWKEGRLIVRVNFNGFIGALGTYATPQETSLLAQNADYVDLMAYDGYTGNKGD
KTGPFSALTGGDCPKIPYLSNGIKELLQVMNYQGFSPQKLILGFTGYGRLFYLPQQFDMK
TDISQVAYGAAPQGGWADNLNGTVDSCNRVRGYEGIYLLTEILNNGWLARDGVTSTQVLT
RGWDECSKQPYLYDNKHLLVYDDPGSLSIKSNHAKQSGLAGVSL

Enzyme Prediction     

EC	3.2.1.14:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	41	403	5.2e-30	0.9087837837837838

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214753	Glyco_18	1.11e-28	41	403	1	327	Glyco_18 domain.
395573	Glyco_hydro_18	1.29e-26	41	404	1	301	Glycosyl hydrolases family 18.
119351	GH18_chitolectin_chitotriosidase	2.32e-26	112	402	74	333	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.
225862	ChiA	4.68e-23	112	402	130	415	Chitinase, GH18 family [Carbohydrate transport and metabolism].
119365	GH18_chitinase	4.93e-20	112	402	88	314	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAP42832.1|GH18	2.26e-55	5	402	4	398
CRX79101.1|GH18	3.32e-38	93	402	23	335
CDR43393.1|GH18	1.37e-34	41	402	25	385
AFD19009.1|GH18|3.2.1.14	1.77e-31	57	404	92	436
CAC35202.1|GH18	1.02e-26	56	404	64	409

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WL0_A	1.43e-17	115	402	86	351	Crystal structure of Ostrinia furnacalis Group I chitinase catalytic domain E148A mutant in complex with a(GlcNAc)2 [Ostrinia furnacalis]
3WKZ_A	1.93e-17	115	402	86	351	Crystal Structure of the Ostrinia furnacalis Group I Chitinase catalytic domain E148Q mutant [Ostrinia furnacalis]
3WL1_A	2.59e-17	115	402	86	351	Crystal structure of Ostrinia furnacalis Group I chitinase catalytic domain in complex with reaction products (GlcNAc)2,3 [Ostrinia furnacalis],3WQV_A Crystal structure of Ostrinia furnacalis Group I chitinase catalytic domain in complex with a(GlcN)5 [Ostrinia furnacalis],3WQW_A Crystal structure of Ostrinia furnacalis Group I chitinase catalytic domain in complex with a(GlcN)6 [Ostrinia furnacalis]
3W4R_A	4.71e-17	115	402	104	369	Crystal structure of an insect chitinase from the Asian corn borer, Ostrinia furnacalis [Ostrinia furnacalis]
1ITX_A	7.95e-15	105	402	119	398	Chain A, Glycosyl Hydrolase [Niallia circulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P36362|CHIT_MANSE	1.35e-16	112	402	99	367	Endochitinase OS=Manduca sexta OX=7130 PE=2 SV=1
sp|Q91Z98|CHIL4_MOUSE	3.40e-16	108	402	89	357	Chitinase-like protein 4 OS=Mus musculus OX=10090 GN=Chil4 PE=1 SV=2
sp|P20533|CHIA1_NIACI	6.92e-14	105	402	151	430	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
sp|Q13231|CHIT1_HUMAN	1.54e-13	112	402	93	355	Chitotriosidase-1 OS=Homo sapiens OX=9606 GN=CHIT1 PE=1 SV=1
sp|Q62010|OVGP1_MOUSE	2.95e-13	82	402	56	352	Oviduct-specific glycoprotein OS=Mus musculus OX=10090 GN=Ovgp1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000377	0.999595	CS pos: 20-21. Pr: 0.9756

TMHMM  Annotations     

There is no transmembrane helices in PTTG_02854-t43_1-p1.