CAZyme Information: PTTG_02759-t43_1-p1

Basic Information

• Species: Puccinia triticina
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia triticina
• CAZyme ID: PTTG_02759-t43_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
579		62959.14	6.0937

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ptriticina1-1BBBDRace1	15692	630390	814	14878

• Gene Location: location=ADAS02000015.1:1035977-1038661(+)

Full Sequence      

MLDSFDYIVVGGGLAGLTVASRLSENPKLSVLVLEAGGTGIGNQCISTPGLIRTNLGSEI
DWKYFTVPQEGANHRQIAYTRGKVLGGTSALNFLVSAKAEAEDYNAIESLGNPGWGWPEI
DRASKKSERLITPPADSGYIFNSTKHGEDGPVTNSFPKYIPAHFRPYFSASASAGHASQN
EDSFGGKIRGAYVYPSAVDTKGARVTSATAYYFPHQSRPNLVVRTDCEVNKLILERNDGI
SGIKVLGVEYNKDGSPSRVTAKKEVIISGGSIGSPAILERSGIGKEEILEPLKIPIALNL
EGVGSNLSDHLTVIATYRLKPGHRTVDDLSRDPQYAAEQKLIYEKSGGGVYSHAISVLDF
QSLKSIVSEDEMQQGLKLLEDCPSYMHPKQFEAVVNRIKNGVVIEFFLIDGFLEFNLPAD
KDTPYLTVGIILQHPLSRGSSHITSQDPSAAPAIDPQFLVHPFDSWLMVQGAKHNRKIMG
QEAFKDTIVNEQYPGSSVRTDEEWEESIRSRLSTAHHPFGTCSMLPQSESGVVDPQLKVY
GTQNLRVVDASILPVQLSAHPAMTVYAIAEKAAEMILKD

Enzyme Prediction     

No EC number prediction in PTTG_02759-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	4	579	8.6e-176	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	5.17e-99	1	579	4	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	6.29e-89	1	577	2	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	9.80e-45	435	572	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.76e-25	72	312	14	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	3.30e-21	4	579	55	579	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KIS68002.1|AA3_2	2.94e-119	5	576	59	632
SAM84677.1|AA3_2	9.87e-118	5	579	60	638
CDI54770.1|AA3_2	2.04e-116	3	576	57	633
CBQ68668.1|AA3_2	3.95e-116	5	576	59	632
SJX64303.1|AA3_2	3.95e-116	5	576	59	632

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	2.25e-91	4	579	5	567	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	1.91e-81	5	579	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.05e-80	5	579	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6ZE2_A	1.46e-73	3	579	4	585	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6XUT_A	3.03e-67	3	576	15	587	Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUU_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUV_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A5C1RDA6|ASC9_DIDFA	8.62e-94	3	579	12	619	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|Q5GMY3|GMCH_MALSM	2.21e-93	4	577	46	616	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	2.21e-93	4	577	46	616	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|A0A161CEV4|CITC_MONRU	6.31e-89	5	579	14	611	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	6.31e-89	5	579	14	611	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999712	0.000298

TMHMM  Annotations     

There is no transmembrane helices in PTTG_02759-t43_1-p1.