CAZyme Information: PTTG_02758-t43_1-p1

Basic Information

• Species: Puccinia triticina
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia triticina
• CAZyme ID: PTTG_02758-t43_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
617	ADAS02000015.1|CGC3	66379.95	6.1023

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ptriticina1-1BBBDRace1	15692	630390	814	14878

• Gene Location: location=ADAS02000015.1:1042379-1045078(+)

Full Sequence      

MLDHGSKIFGLLFLALLPRGSNTATMPEMFDYIVVGGGQAGMAVASRLSEDPSLSVLVLE
AGGTGINNTGISIPGLVGTTLGTDVDWKYSTVPQAGANKRQVYYPRGKVLGGSSAINFLI
STKAEKKDYDAIERLGNPGWGWSEVDRASKKSEKLVIPPPDSPFLYNPLYHGLSGPVASS
FPKYVPPQFKPYFPAAVMASIPARAIETTDPFGGDLEGAYIFPSAIDAKSARVTSATAYY
FPHQSRPNLVVRTHAEVNKLISKKTDGQSLQILGVEYSSFGTVSRAMVNKEVIMSAGSIG
TPAILERSGIGKSSILQALNIPVALDLPAVGANLADHPALLGTYRLKSGIVSSDDLMRNA
TFAAEQTSLYMSTGGGLLSHGISVLDYQSLKSIVTPEELLEGLKLLERDPSVMSQEQFDA
ISERILNGVAVEFLLINAFFESDNAPDPDTSYLTIATTLQHPLSRGSSHINGQDPLLTPL
IDPAFLSHPFDAWLMVQAAKHARKIMEQPQYKNIILNEQFPGPSVQSDAEWLVSVKNRVR
TEYHPLGTCALMPQDRAGVVDPQLKVYGTENLRVVDASVIPIQIGAHPALTIYAIAEKAA
ELILNPTTKTLLPNLLQ

Enzyme Prediction     

No EC number prediction in PTTG_02758-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	29	604	3.2e-174	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.14e-100	23	605	1	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.07e-97	25	613	1	538	choline dehydrogenase; Validated
398739	GMC_oxred_C	1.02e-43	462	599	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.24e-30	97	339	14	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	4.08e-25	28	592	54	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW13132.1|AA3_2	1.24e-125	16	603	21	619
QRV98565.1|AA3_2	6.91e-125	11	603	10	619
QRV98567.1|AA3_2	2.98e-122	16	603	21	615
CDR49038.1|AA3_2	1.82e-118	30	604	54	632
KIS68002.1|AA3_2	3.71e-118	28	603	57	632

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	5.10e-89	22	603	2	564	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	1.30e-81	30	603	2	561	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	7.13e-81	30	603	3	562	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6ZE2_A	7.99e-79	30	603	6	582	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6O9N_A	2.76e-62	30	605	36	640	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A2H3D1U1|ARMD5_ARMGA	1.56e-90	19	603	24	629	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	2.44e-88	30	603	14	608	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A161CEV4|CITC_MONRU	2.44e-88	30	603	14	608	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	3.54e-87	31	604	15	617	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|M5EAX2|GMCH_MALS4	3.47e-86	28	605	45	617	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.002074	0.997900	CS pos: 23-24. Pr: 0.9565

TMHMM  Annotations     

There is no transmembrane helices in PTTG_02758-t43_1-p1.