CAZyme Information: PTTG_02736-t43_1-p1

Basic Information

• Species: Puccinia triticina
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia triticina
• CAZyme ID: PTTG_02736-t43_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
616		68531.10	7.3670

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ptriticina1-1BBBDRace1	15692	630390	814	14878

• Gene Location: location=ADAS02000057.1:29577-32571(+)

Full Sequence      

MMSNVLKRVQAGCLPWGFCLLGLATSSALNTAKGSLPATARVSSRLLERHSSAAGFVSAL
GSKSDFVSAPGDGHLYINDTLFDFRSFNSPTIFEGGEFQGRDLIQTISAFGSPVTRTYTL
HVANTMFTDGREPPSSSHILGWDDNASDWIYNETNWRKIDKILDLSRQYGIRLIIPIINQ
DYGTSGTNWVGNFNDLIRHRYGIEDYTVANQAVDWFTDPEMIRSYKQIIAFFLNRINTFN
GIRIGNDETVLAFETGNEMNWGDKNQKIYKRAAPASWTIEIAQHIKSLAPKTLVMDGSFS
RNPSAAWNDEVLDSPFVDLFSYHFYGTGDTRFYKNLQDLVQLHEKTFIVGEHGFYEKAET
YEAFYKNITCAGAFVWSLLPHSEKGGFLTHGEGHNIFAYHAPGFKNQTSKNFDTQEAEVI
SSTYNASYRILGLEPPPKPVPGPPEAFLLNNGTTYGISWRGSAWAQRYQILGAGAKNKNN
LRVISKYIPDNVDAGQLFIPLKPNEPTKPIKITLSRPVPKKLHTGWVDNKWCAPESPASC
PKKSNFSRQDNPEDSISYPGQPFDKGTIEDTQKLHSPVQLGAIVPEDSSSGGWFAVRAIS
ADGVPGKISKPVFLKT

Enzyme Prediction     

EC	3.2.1.78:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	101	386	2.9e-50	0.9921875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	0.004	140	329	45	199	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALL41339.1|GH5	3.50e-101	137	455	5	348
CDR43041.1|GH5	5.95e-101	62	501	44	479
ALL40758.1|GH5	2.27e-59	293	612	1	319
UJF31796.1|GH5_41	5.76e-55	64	470	31	421
AYQ73430.1|CBM23|CBM61|GH5	4.37e-51	66	495	60	469

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QP0_A	4.41e-13	64	325	2	258	Crystal Structure Analysis of the Endo-1,4-beta-mannanase from Rhizomucor miehei [Rhizomucor miehei]
3PZ9_A	6.34e-09	153	297	96	223	Native structure of endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3PZG_A I222 crystal form of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3PZI_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 in complex with beta-D-glucose [Thermotoga petrophila RKU-1],3PZM_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with three glycerol molecules [Thermotoga petrophila RKU-1],3PZN_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with citrate and glycerol [Thermotoga petrophila RKU-1],3PZO_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 in complex with three maltose molecules [Thermotoga petrophila RKU-1],3PZQ_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with maltose and glycerol [Thermotoga petrophila RKU-1]
1RH9_A	8.09e-09	118	297	54	213	Chain A, endo-beta-mannanase [Solanum lycopersicum]
6TN6_A	1.02e-08	153	297	82	209	X-ray structure of the endo-beta-1,4-mannanase from Thermotoga petrophila [Thermotoga petrophila RKU-1]
4LYP_A	6.27e-06	151	301	123	270	Crystal Structure of Glycoside Hydrolase Family 5 Mannosidase from Rhizomucor miehei [Rhizomucor miehei],4LYP_B Crystal Structure of Glycoside Hydrolase Family 5 Mannosidase from Rhizomucor miehei [Rhizomucor miehei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9LZV3|MAN6_ARATH	1.14e-11	102	325	87	299	Mannan endo-1,4-beta-mannosidase 6 OS=Arabidopsis thaliana OX=3702 GN=MAN6 PE=2 SV=1
sp|Q6YM50|MAN5_SOLLC	3.97e-10	66	297	39	246	Mannan endo-1,4-beta-mannosidase 5 OS=Solanum lycopersicum OX=4081 GN=MAN5 PE=2 SV=1
sp|Q9FZ03|MAN2_SOLLC	3.97e-10	66	297	39	246	Mannan endo-1,4-beta-mannosidase 2 OS=Solanum lycopersicum OX=4081 GN=MAN2 PE=2 SV=2
sp|Q0JKM9|MAN1_ORYSJ	5.34e-09	151	288	111	236	Mannan endo-1,4-beta-mannosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=MAN1 PE=2 SV=2
sp|Q5W6G0|MAN5_ORYSJ	1.88e-08	102	298	118	285	Putative mannan endo-1,4-beta-mannosidase 5 OS=Oryza sativa subsp. japonica OX=39947 GN=MAN5 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.401491	0.598494	CS pos: 28-29. Pr: 0.5042

TMHMM  Annotations     

There is no transmembrane helices in PTTG_02736-t43_1-p1.