CAZyme Information: PTTG_02691-t43_2-p1

Basic Information

• Species: Puccinia triticina
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia triticina
• CAZyme ID: PTTG_02691-t43_2-p1
• CAZy Family: GH152
• CAZyme Description: hypothetical protein, variant

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
542		61506.77	8.5875

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ptriticina1-1BBBDRace1	15692	630390	814	14878

• Gene Location: location=ADAS02000057.1:478186-480648(-)

Full Sequence      

MSTSYSDQIPIRRKPPAPVEHSPYNIQAEKQPILRPANRDEGRHAYRPGPPARPIPKYEP
PELADDLRELVPLLLYTLASLATRLYKIGQTNTVVWDEAHFGKFGAYYLNQTFYFDVHPP
LAKMMVGLAGVLSGFDGTYDFPSGQVYPKHVPFTSMRILLALPGVALVPIAWATALELGF
SEYSRHIVTMMVLTDIAFTAISRFILLDSTLLFFTFTTVYCLACFHNQRRYPFDFEWWFW
LAMTGLSIGCVASVKWIGLFVTALVGAHTADELWEKFGDLRMPLRTYLKHWAARIICLIV
LPVLVYMSCFKIHFMVLNRSGPGDAQMSSLFQANLVGNNFARSPLEIAIGSRVTIKNMGY
GGGLLHSHVQSYPTGSQQQQVTCYHYRDANNDWTVTPLLHEPAYNESQPIRFVKHGSVVR
LVHVLTGRNLHTHTIPAPITTLNHEVAGYGNATIDDSNSYWMIEVVDDMIRGKRKNFENI
NILSTRFRIRNLNLGCYLRAANAVLPQWGFKQVEVSCDKQNDPSDHHTYWNIEGHVNPRR
NS

Enzyme Prediction     

EC	2.4.1.109:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	77	314	1.2e-67	0.9865470852017937

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224839	PMT1	2.12e-155	67	539	21	483	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
396786	PMT	9.79e-82	77	318	4	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
397103	MIR	4.29e-28	364	525	11	180	MIR domain. The MIR (protein mannosyltransferase, IP3R and RyR) domain is a domain that may have a ligand transferase function.
197746	MIR	1.06e-11	410	466	1	57	Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases.
197746	MIR	1.32e-08	347	397	4	56	Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR37398.1|GT39	8.65e-253	62	539	163	641
QRV74898.1|GT39	1.00e-227	42	539	71	565
QRW03799.1|GT39	1.00e-227	42	539	71	565
QRV89589.1|GT39	1.95e-227	42	539	70	564
CCA70916.1|GT39	8.59e-225	20	539	87	608

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P25_B	1.29e-161	67	539	62	533	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_B Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P25_A	4.87e-74	51	538	25	517	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_A Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6ZQP_A	1.85e-57	340	539	16	214	Structure of the Pmt2-MIR domain with bound ligands [Saccharomyces cerevisiae]
6P28_A	5.68e-57	342	537	1	195	Crystal structure of the MIR domain (aa 337-532) of the S. cerevisiae mannosyltransferase Pmt2 [Saccharomyces cerevisiae]
6ZQQ_A	1.16e-52	344	539	12	207	Structure of the Pmt3-MIR domain with bound ligands [Saccharomyces cerevisiae],6ZQQ_B Structure of the Pmt3-MIR domain with bound ligands [Saccharomyces cerevisiae],6ZQQ_C Structure of the Pmt3-MIR domain with bound ligands [Saccharomyces cerevisiae],6ZQQ_D Structure of the Pmt3-MIR domain with bound ligands [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P31382|PMT2_YEAST	6.65e-161	67	539	62	533	Dolichyl-phosphate-mannose--protein mannosyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT2 PE=1 SV=2
sp|P47190|PMT3_YEAST	3.53e-159	65	539	53	527	Dolichyl-phosphate-mannose--protein mannosyltransferase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT3 PE=1 SV=2
sp|Q9C100|PMT2_SCHPO	4.16e-157	70	539	59	525	Dolichyl-phosphate-mannose--protein mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ogm2 PE=3 SV=1
sp|Q5ADM9|PMT2_CANAL	2.78e-150	59	537	52	536	Dolichyl-phosphate-mannose--protein mannosyltransferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT2 PE=1 SV=1
sp|P42934|PMT6_YEAST	2.81e-131	67	537	63	542	Dolichyl-phosphate-mannose--protein mannosyltransferase 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT6 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000065	0.000000

TMHMM  Annotations     

Start	End
158	180
201	223
238	260
295	317