CAZyme Information: PTTG_02663-t43_1-p1

Basic Information

• Species: Puccinia triticina
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia triticina
• CAZyme ID: PTTG_02663-t43_1-p1
• CAZy Family: GH15
• CAZyme Description: hypothetical protein, variant

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
489	ADAS02000073.1|CGC1	54240.42	6.4291

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ptriticina1-1BBBDRace1	15692	630390	814	14878

• Gene Location: location=ADAS02000073.1:90521-92776(-)

Full Sequence      

MRLGLLSTLRQVVKTLVLLDLLLLSHPTSSARLESSNAPKLVFAHFITGLTVNYTRSDWS
SQCNLAASHGIDAFALNVGLPDGWQLQQVKDAYEVADAIKTTTGKAFKLFLSLDMSVIQS
AEDVTTWVTSFVPLPAQLLINGRPLVSTFSGEANKLGGEDLSSGWQAALKAPLARGNPSL
DALFIPAWSSLDPSTAVSDHPVVDGIMTWNSWPTGSENTNTLDDYQFQTNAKASQKLYMA
GVSPCFFTHYKDKNWIYRSDDNLYISRWMKLMSMPTPPDFIQIISWNDYGESHYIGPRLG
TPPADTTWLDGFDHQAWLKMSDYFIKWYKTGVRPTIEEDTVHFNYRPHSVNAIATSDTLP
PPTNSSVSVDAIYVSAYLSASSPATQLRIRVGDMQQSFSNITRSEVNTFTAPWNGHTGRV
EVALLDNTGKELMKKQGDVPISNDIKTYNFNYAAAILSKDTSGTGPARLLRAPIIISFFI
FHLASWQMW

Enzyme Prediction     

EC	3.2.1.59:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH71	42	427	1.5e-101	0.976

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397634	Glyco_hydro_71	7.87e-135	42	427	1	366	Glycosyl hydrolase family 71. Family of alpha-1,3-glucanases.
211418	GH71	1.27e-96	37	331	2	283	Glycoside hydrolase family 71. This family of glycoside hydrolases 71 (following the CAZY nomenclature) function as alpha-1,3-glucanases (mutanases, EC 3.2.1.59). They appear to have an endo-hydrolytic mode of enzymatic activity and bacterial members are investigated as candidates for the development of dental caries treatments.The member from fission yeast, endo-alpha-1,3-glucanase Agn1p, plays a vital role in daughter cell separation, while Agn2p has been associated with endolysis of the ascus wall.
211414	GH99_GH71_like	1.68e-25	42	319	1	277	Glycoside hydrolase families 71, 99, and related domains. This superfamily of glycoside hydrolases contains families GH71 and GH99 (following the CAZY nomenclature), as well as other members with undefined function and specificity.
211416	GH99_GH71_like_3	1.06e-09	82	297	118	309	Uncharacterized glycoside hydrolase family 99-like domain. This family of putative glycoside hydrolases resembles glycosyl hydrolase families 71 and 99 (following the CAZY nomenclature) and may share a similar catalytic site and mechanism.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALL41113.1|GH71	3.84e-198	26	459	31	465
AAT84064.1|GH71|3.2.1.59	2.04e-86	30	457	12	422
CCA70335.1|GH71	7.09e-74	23	384	42	399
CED85561.1|GH71	1.96e-73	36	452	348	757
CED82064.1|GH71	7.00e-69	40	452	127	542

PDB Hits     

PTTG_02663-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O13716|AGN1_SCHPO	3.63e-87	30	457	12	422	Glucan endo-1,3-alpha-glucosidase agn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=agn1 PE=1 SV=2
sp|O94510|AGN2_SCHPO	2.91e-64	31	458	2	432	Ascus wall endo-1,3-alpha-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=agn2 PE=1 SV=2
sp|B6GX22|MU71A_PENRW	2.27e-54	24	468	20	442	Mutanase Pc12g07500 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=PCH_Pc12g07500 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000234	0.999761	CS pos: 31-32. Pr: 0.9629

TMHMM  Annotations     

There is no transmembrane helices in PTTG_02663-t43_1-p1.