CAZyme Information: PTTG_02471-t43_3-p1

Basic Information

• Species: Puccinia triticina
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia triticina
• CAZyme ID: PTTG_02471-t43_3-p1
• CAZy Family: GH131
• CAZyme Description: hypothetical protein, variant 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
525		60449.09	8.3591

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ptriticina1-1BBBDRace1	15692	630390	814	14878

• Gene Location: location=ADAS02000004.1:123438-125133(+)

Full Sequence      

MWKLPTSRRFWALIIAISILVIIFWQHIFLLARILLVYPLWSTYSSSLSLSIGKDGLDPT
FEKYPVEQWSVKWPPRSANGSWPAPDSSLLRLSDGSLARLPDERYGGGVSYSEPDELDLV
PPILHHILLGMDRRLMPKTWTASRNSCLALHPESANFTHHFWDDQSAEEFMRKHYSFFLR
DFLDYRHTIQRADALRYFVLHHYGGIFLDMDLECRRSLGPLRRFPIVNINASPVGVSNGF
MMAQAKHPFLEQLIKSLQYYDHTWFGVPYFDIMLSTGPMFLSTEHLHFPADHRSTQLRVL
AERQHRLNGRVATPLFRHLGASSWHQGDAKLFLKIRVMVYQPFFSLMLFCGFIGGSVGWM
VWKKQIAKPGVDRSWSHSCQSSEVRRFSAGRLILWRFGLGSRRGHRRTPEEYERIEMDLE
SPLIGDRRLSPILEVEEEVEAKFDHELEHKHSILNFGRKRPAYNTLKSPTTPSVFMDETE
SLYQIGNGSSSGGSCPSTSSDPEDDGSSAEAVVVLIDRHPSKWRN

Enzyme Prediction     

No EC number prediction in PTTG_02471-t43_3-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	140	221	2.3e-18	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.31e-26	107	282	69	237	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.97e-12	137	221	1	86	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFN02868.1|GT32	7.11e-155	62	428	1	381
UJR26144.1|GT32	2.27e-69	7	341	16	302
ANH56537.1|GT32	1.76e-56	118	368	85	323
UNI15446.1|GT32	4.82e-56	118	335	87	296
QPH09562.1|GT32	1.85e-55	118	368	85	323

PDB Hits     

PTTG_02471-t43_3-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P33300|SUR1_YEAST	4.66e-42	114	331	49	258	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|P38287|CSH1_YEAST	1.51e-41	86	329	25	264	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|O14084|IMT1_SCHPO	2.65e-37	112	335	56	272	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|Q10323|IMT3_SCHPO	1.53e-31	120	329	57	259	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	3.21e-31	79	333	55	290	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999980	0.000042

TMHMM  Annotations     

Start	End
7	29
337	359