CAZyme Information: PTTG_02261-t43_1-p1

Basic Information

• Species: Puccinia triticina
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia triticina
• CAZyme ID: PTTG_02261-t43_1-p1
• CAZy Family: GH13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
488		53397.37	4.1690

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ptriticina1-1BBBDRace1	15692	630390	814	14878

• Gene Location: location=ADAS02000065.1:68315-70763(-)

Full Sequence      

MVTLVSPHIYQVTDTFIAVNFPGPLKMVSPLLILILTCLPALAMTQTTSDDDPLSISSSS
DFSESYEFPASIKAENTTDIPTDDTSPPLENDDSTNYDATASPARKLAGYYPVYNTDEKS
LSELRFDLYDEIIFFAATTTDNFTIGTDYFTQAEWDAMAFDFVKSCKEHSVIPTYALGGW
GGSRYFSSLVATADNRTAFADAVITFAKKYGFEGVDFDWEYAGIQGIGCNIISDQDAQNQ
QMLFKEVKSRWPEGKLSTTQSIAGIRDPDYQQLPASNTTMMVEAIDNLRIMAYDVHGSFT
ATTGPNAPIRSQCADPENQLSIEGAIEIYIKQGFKPEQISLGIPGYAISWSLAKPELAPR
IVGNYTSYYYQNFTGIPRGGKFDEKPGLDSCGQPTGYGGQWNAHELVESGFLSDDEASGG
NGYTRYYDACSGEPFIASNTTLISYDDAESTVSKVKFANSKGLGGVFFFDTMGPRDSTVK
AARKAMLN

Enzyme Prediction     

EC	3.2.1.14:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	105	471	1.5e-46	0.9256756756756757

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214753	Glyco_18	3.19e-50	106	470	1	330	Glyco_18 domain.
395573	Glyco_hydro_18	1.17e-46	106	470	1	303	Glycosyl hydrolases family 18.
225862	ChiA	1.85e-44	72	482	2	431	Chitinase, GH18 family [Carbohydrate transport and metabolism].
119365	GH18_chitinase	4.37e-44	176	468	90	316	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
119351	GH18_chitolectin_chitotriosidase	1.48e-39	176	468	76	335	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAP42832.1|GH18	6.73e-111	93	488	23	420
ALL41259.1|GH18	6.21e-83	291	487	1	199
CDR43393.1|GH18	1.05e-69	99	486	19	405
CRX79101.1|GH18	1.66e-63	162	467	30	336
CDR44918.1|GH18	3.04e-55	161	486	94	402

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BT9_A	1.35e-32	176	473	163	447	Chitinase ChiA74 from Bacillus thuringiensis [Bacillus thuringiensis],6BT9_B Chitinase ChiA74 from Bacillus thuringiensis [Bacillus thuringiensis]
1ITX_A	1.43e-31	176	487	128	419	Chain A, Glycosyl Hydrolase [Niallia circulans]
5XWF_A	4.92e-28	114	466	7	347	Chain A, Fungal chitinase from Rhizomucor miehei (SeMet-substituted proteins) [Rhizomucor miehei]
1HKK_A	1.97e-25	176	465	74	333	High resoultion crystal structure of human chitinase in complex with allosamidin [Homo sapiens]
1HKI_A	2.00e-25	176	465	74	333	Crystal structure of human chitinase in complex with glucoallosamidin B [Homo sapiens],1HKJ_A Crystal structure of human chitinase in complex with methylallosamidin [Homo sapiens],1HKM_A High resolution crystal structure of human chitinase in complex with demethylallosamidin [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P20533|CHIA1_NIACI	6.65e-30	176	487	160	451	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
sp|Q13231|CHIT1_HUMAN	4.37e-24	176	465	95	354	Chitotriosidase-1 OS=Homo sapiens OX=9606 GN=CHIT1 PE=1 SV=1
sp|Q95M17|CHIA_BOVIN	2.76e-23	151	465	67	356	Acidic mammalian chitinase OS=Bos taurus OX=9913 GN=CHIA PE=1 SV=1
sp|Q9W092|CHIT2_DROME	1.79e-22	176	466	123	381	Probable chitinase 2 OS=Drosophila melanogaster OX=7227 GN=Cht2 PE=1 SV=1
sp|A0A072VEP0|CHT5A_MEDTR	5.93e-22	161	469	90	364	Class V chitinase CHIT5a OS=Medicago truncatula OX=3880 GN=CHIT5A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.500357	0.499647

TMHMM  Annotations     

There is no transmembrane helices in PTTG_02261-t43_1-p1.