CAZyme Information: PTTG_02186-t43_1-p1

Basic Information

• Species: Puccinia triticina
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia triticina
• CAZyme ID: PTTG_02186-t43_1-p1
• CAZy Family: GH13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
638		70229.61	7.5968

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ptriticina1-1BBBDRace1	15692	630390	814	14878

• Gene Location: location=ADAS02000093.1:211471-214018(-)

Full Sequence      

MCSVHFVTSCLLIWFMRATLVSSSYHHHQEKRQLELPSLPVLGSIFKNKTYDYVVVGAGT
AGMTIAARLSEDPNVNVAVVEAGIDYELSPVNKILVDTPGADGIGCGSSPDDAINDAIDW
RFKTTPQSGANNRTIRYARGKTIGGSSARNIMIYHRASKGSVDQWATLTGDPDWTFENRF
VDYQKSVSFTAPKHDLRQEIPAAQYDRLAFTQANGPVQISYPNTAQPFSKYMQLSLNEKG
IPTSQDFNGGTLKGVQYAPATIDPKDSHRSSSRAFFSAARSRSNLVVYTTALVKRIIFNE
STPPQAQGVEFVYTLTGLYDKLIAKKEVIVSAGAFQSPQLLMVSGIGPKDQLTSHNIPIR
VESPNVGRGLQDHIIYGPTYPVHSIQTLTRLAVHPTYAISQYLNFTIRQQGPMTNNAADM
ISFERFNITKLNLDEASAHSLSAYPNDWPHVEYLSAPGLVGDFSNLFKLNLVAGTTTGKE
FVAILVALVAPQSRGSIRITSNDMSVPPLIDPGWLSDPVDQKIAIEAFKRTREFFSAQAM
QPILDGQEYLPGPSVKSEEQILDWIRNNTMTMWHAACTCSMRTQDQGGVLDSHFRVYGAK
NLRVVDASAFPSLPPGHPQSTVYMIAERAATLIKQEQV

Enzyme Prediction     

No EC number prediction in PTTG_02186-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	49	635	5.7e-185	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.75e-101	47	634	2	532	choline dehydrogenase; Validated
225186	BetA	1.69e-100	48	637	5	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	9.26e-44	491	629	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	1.20e-30	50	625	55	568	Protein HOTHEAD
366272	GMC_oxred_N	5.16e-26	130	373	14	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SAM82705.1|AA3_2	2.62e-201	29	633	30	625
CBQ73647.1|AA3_2	5.44e-196	29	633	30	627
SJX63486.1|AA3_2	1.09e-195	29	633	30	627
CDR88463.1|AA3_2	1.14e-192	28	633	29	627
CDI54067.1|AA3_2	1.78e-191	18	633	16	626

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	2.09e-73	51	637	2	565	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
4YNT_A	6.52e-73	50	636	5	567	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
3FIM_B	3.07e-72	51	637	3	566	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6ZE2_A	1.17e-69	48	636	3	585	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6O9N_A	8.26e-63	51	636	36	641	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B8A1|PKFF_EMENI	2.43e-147	46	635	36	609	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|A1CFL2|PATE_ASPCL	4.61e-146	41	630	38	621	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1
sp|A0A075TRK9|PATE_PENEN	9.19e-146	22	630	27	621	Patulin synthase OS=Penicillium expansum OX=27334 GN=patE PE=1 SV=1
sp|A0A1U8QYA8|CICC_EMENI	1.04e-123	34	633	14	607	Oxidoreductase cicC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicC PE=1 SV=1
sp|Q12062|AFLK_ASPPU	3.83e-119	49	630	73	636	Versicolorin B synthase OS=Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1) OX=1403190 GN=aflK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.664311	0.335700

TMHMM  Annotations     

There is no transmembrane helices in PTTG_02186-t43_1-p1.