CAZyme Information: PTTG_02061-t43_1-p1

Basic Information

• Species: Puccinia triticina
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia triticina
• CAZyme ID: PTTG_02061-t43_1-p1
• CAZy Family: GH10
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1627		179165.05	5.9649

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ptriticina1-1BBBDRace1	15692	630390	814	14878

• Gene Location: location=ADAS02000058.1:227551-234157(+)

Full Sequence      

MKRPRGLRDRLALLLALGVPARAGSPPITVSIQATWPEPAMVVQVLESVALERPGLFFPS
LDAACSAWAETGPAPPATDQQTYEHLVGLLRTPGLLDRPAELEALAFSIALKEAHPAIEA
FRAWYSSLPPTLTRPSDAHNHSCQSWALVGSARVCDFSKLSEILDSNDFSQTTHAQPQVL
PFDHQQGQASGKTRLPTVILYASPDPRSFCPFHQVLHKASTTIPAKAAYIFRWIIPSAPT
AASKSSASLLSGWGASLDIKKSEYLTLDDRPVESASSEDPAQVVPDGHPAAATETALDSS
EQAKLKPLKAAEIFDIGAKATQHVLSSPSPLSALRRLTEDFPLIAHTLANEWVPGRISRE
LRLELKENMAEGIPPGQSVVWMNGLQLSPLVSLENLNLFKLVEIMRSERRWITALTALGF
TSRQARALVVDEKLNAAMNPEAASAASAGGEIDASALGARFDASDRQEGGGAILWFNDLE
KDERYSMWPTTLRAILRPTFPGQLHPIGRNIINVVLGLDLTRSQNLHNLGHVIEVFISRS
LPIRWGFVPIPTKDPAQAERMTRCFWDLVEALGPIETLRFVKEFTAEFEPDAGTVDVEDF
LAKASQRVSATNGSPDDAPSQDEKFAVWLAKSQLYSSRLSLCSNDHSLPACMMINGRFFP
MEENYRSHLQETATLHTGFIQHQVYFNLLKDDADVAEYLYDLPLVHRARNDLVFPSEARP
LRFVDLAETLRSTDALAANVFFHNHDAPGDDDAARPIASLWVVGDLDSSGGMAAVAAALG
VLMKPSPDVSVQVSFVHVSSDEAETSAEISAGLATHITGSGDEPVAVQDLLAQLRRHGHP
VVAPHPQGTPAVSDHDADELVLRIVRRNRLHRAPTKSAAWVGAQQFASAVRAQSGSIAII
INGRVLQVSSGTKLLSEDLVLLVEYEAQQRITPLVEALKGLDEFEFGRHRANVPMIMATV
GYVLVGSSDDSSSPAETRSDKHLSRNGRYSSYQHGDHAKALFDFSVVLNPASEAAQRWSA
LLETLSHRSDVAIKVWFNPSLELTELPIKRFFRTAISNSLEFDKNGRVVPALVSFQGIPT
ETLFTLAIDTPPAWLALPHDSIHDLDNIMLSELPAAYSSQGVEAIFQLEHIILAGHAREV
PSDIPPRGLQIVLSDLLRNTEVDTIIMANLGYFQFKSAPGIHRLSIRPGRSLELYQFEKP
ESGGPDAEPYQALSLATFNGLTIYPRVRKRPEKSAESLIQPLSTSPTSSRKGPAGEFSKL
MGQVKDLATGMLKSHGLDLANGTSRSVINVFTVASGLLYERMAYLMCVSVMRHTTSPVKF
WFISNFLSPSFKRFIPHLAREYRFDYQLVTYRWPSWLRAQKEKQRVIWGYKILFLDVLFP
LEVDRVIFVDSDQIVRTDLKALVDLDLGGAPYAYAPMCNDRNETKGFRFWDTGYWKESLQ
GRPYHISALYVVDLRVFRTVAAGDQLRQHYQALSADPGSLANLDQDLPNNMQGILPIFTL
DQSWLWCETWCSDEGLKTAKTIDLCNNPLTHEPKLKRARRLIPEWDAYDQEVAGLASRVK
KNTHGEDDPAAMITVQAGQKIDDDERASTAPAEEDVLPDSQPSKHGSADDHQHSPGGHDG
GGSRDEL

Enzyme Prediction     

EC	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1288	1535	2.7e-123	0.9959677419354839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408203	Glyco_transf_24	0.0	1288	1555	1	268	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
133054	GT8_HUGT1_C_like	2.45e-164	1288	1535	1	248	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
408201	Thioredoxin_14	6.47e-71	461	713	1	248	Thioredoxin-like domain. This is the third out of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
132996	Glyco_transf_8	2.47e-57	1288	1528	1	241	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
408200	Thioredoxin_13	2.03e-40	300	439	1	132	Thioredoxin-like domain. This is the second out of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR47046.1|GT24	1.35e-317	11	1609	6	1681
CCA74280.1|GT24	2.38e-297	27	1589	26	1558
QRV75871.1|GT24	7.62e-297	25	1556	23	1531
QRV90671.1|GT24	1.17e-295	25	1556	23	1531
AUB22656.1|GT24	1.28e-289	11	1575	6	1551

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MU1_A	4.00e-274	23	1561	6	1453	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5NV4_A	4.32e-273	23	1561	6	1453	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TRT_A	6.07e-273	23	1561	6	1453	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS8_A	7.10e-235	25	1497	1	1382	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS8_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS2_A	9.18e-204	886	1561	537	1219	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09140|UGGG_SCHPO	1.26e-223	27	1555	21	1424	UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpt1 PE=1 SV=2
sp|Q9NYU2|UGGG1_HUMAN	2.44e-195	22	1561	41	1529	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3
sp|Q6P5E4|UGGG1_MOUSE	2.25e-194	2	1555	16	1523	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4
sp|Q9JLA3|UGGG1_RAT	1.63e-193	2	1555	16	1523	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Uggt1 PE=1 SV=2
sp|Q09332|UGGG_DROME	7.93e-193	13	1567	12	1521	UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=Uggt PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000546	0.999427	CS pos: 23-24. Pr: 0.9625

TMHMM  Annotations     

There is no transmembrane helices in PTTG_02061-t43_1-p1.