CAZyme Information: PTTG_01711-t43_1-p1

Basic Information

• Species: Puccinia triticina
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia triticina
• CAZyme ID: PTTG_01711-t43_1-p1
• CAZy Family: CE8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
418	ADAS02000013.1|CGC1	45003.36	9.3908

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ptriticina1-1BBBDRace1	15692	630390	814	14878

• Gene Location: location=ADAS02000013.1:1232762-1235003(-)

Full Sequence      

MSLFKSHLRSIFLIFSYVQLVVFASHPKSPGFRKTSGKKVHSLSSKATGNILQITGGGSA
APQAPKDNDQLKAWLADDVPRVILIKTTFDFTSPKVNVSSPGCVPWAPCQNGNQIQQARD
FNNWCSKFYSTHKPAQVLYHEAPLEPLVVKSNKTILGVGSSGVLRGKGLVLHNAHNVKIQ
NIIITQLNPSIVWGGDAIMLDGVSDVLIEHCTFSLVGRQMIVTGGMFSSEANTNVFLMNN
LFDGRTDWSARCQNRHYWTVLISGPADTVTMANNCFDSTSGRSPKTGGAGNPNVLVHYYN
NLHTNIVGETFEIASGSTFLAEGNVIKNAQFENPGDQVTDRGGNAHIPFLDADAQACQGP
LGRPCVKNLIIQSSPYKFGLKKVALQAFQKRPPPNVGPIKAASDIVNGVPGGCGVGHI

Enzyme Prediction     

EC	4.2.2.10:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	137	328	4.3e-68	0.9893048128342246

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	1.12e-35	146	335	11	190	Amb_all domain.
366158	Pec_lyase_C	2.96e-12	144	325	27	210	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.
226384	PelB	8.97e-11	149	330	99	277	Pectate lyase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ48538.1|PL1_4	7.77e-78	43	373	21	340
CCD51274.1|PL1_4	7.77e-78	43	373	21	340
ULM60711.1|PL1_4	1.20e-77	5	375	2	345
APA08244.1|PL1_4	3.72e-76	47	418	25	383
QRW23637.1|PL1_4	1.47e-73	55	370	31	332

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QCX_A	2.03e-71	47	368	7	314	Pectin Lyase B [Aspergillus niger]
1IDK_A	4.44e-70	43	368	3	313	Pectin Lyase A [Aspergillus niger]
1IDJ_A	8.81e-70	43	368	3	313	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8NJK6|PELF_ASPNG	2.88e-71	55	373	36	341	Probable pectin lyase F OS=Aspergillus niger OX=5061 GN=pelF PE=3 SV=1
sp|A2R6A1|PELF_ASPNC	2.88e-71	55	373	36	341	Probable pectin lyase F OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pelF PE=3 SV=1
sp|B8N316|PELF_ASPFN	4.57e-71	55	373	35	340	Probable pectin lyase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelF PE=3 SV=1
sp|Q2UJA7|PELF_ASPOR	4.57e-71	55	373	35	340	Probable pectin lyase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pelF PE=3 SV=2
sp|A2QFN7|PELB_ASPNC	1.84e-70	47	368	27	334	Probable pectin lyase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pelB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.202657	0.797319	CS pos: 24-25. Pr: 0.7517

TMHMM  Annotations     

There is no transmembrane helices in PTTG_01711-t43_1-p1.