CAZyme Information: PTTG_01670-t43_1-p1

Basic Information

• Species: Puccinia triticina
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia triticina
• CAZyme ID: PTTG_01670-t43_1-p1
• CAZy Family: CE8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
710		77003.66	5.1319

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ptriticina1-1BBBDRace1	15692	630390	814	14878

• Gene Location: location=ADAS02000046.1:442203-445073(+)

Full Sequence      

MIGEAKQHLKGDSYLYLFTKIFSSHAPRATQLVQIFIAFSQAHLANRIANHTVFGVESSK
LWALNHRSQLTSVDHQAIVLIGKAFKMASDGIHLSSKASQLDEASETSLAGEMSDEKANW
APADNRASVMNAIYSDQNYLSSASYLLGSNQRPTSAASSYPSFRGSQIDPRRVSRRSYME
DYQDFDAELEDELHNDEGDDDDDNLNGSPKKKSVLVCGNFFSMRGILNMGAVLLLALALV
TIFGVLPVITYLGSHRATKQLAVNSGGYNLGGINGSGQVPLIHNLAGVIDPTTPESVMSR
KGFDGTQYNLVFSDEFSTDGRTFWPGDDPYWEAVDLHYWATGNLEWFDPDAITTNNGNLN
ITLTKEMIHDLNYRSGMLQSWNKFCFTGGYIEVSISLPGSPRISGFWPGAWTMGNLGRAG
YGATTDGTWPYSYNSCDLGTLQNQTNVARTGPAAALRAPGGGSLSFLPGQKLSSCTCPGG
DHPGPSVKAGRGSPEIDIIEAQITAPGSGVNIGQASQSVQFAPFDDGYNWKEDGATVYNP
RTSAINTYKGGIYQEAVSVVSTTDQTAYEATGGKFQTFGFEYTTGPKGSITWSVGDTATW
SMASSAVGPNPNVQISQRVVSEEPMYIILNLAISEAFQTVDVAHLPTPARMLVDYVRVYQ
KQGQENIGCSPKNFPTESYINKHINAYTNPNLTTWDQAGYTFPKNSLTGC

Enzyme Prediction     

No EC number prediction in PTTG_01670-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	314	659	1.4e-143	0.9969325153374233

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397841	SKN1	0.0	184	709	5	498	Beta-glucan synthesis-associated protein (SKN1). This family consists of the beta-glucan synthesis-associated proteins KRE6 and SKN1. Beta1,6-Glucan is a key component of the yeast cell wall, interconnecting cell wall proteins, beta1,3-glucan, and chitin. It has been postulated that the synthesis of beta1,6-glucan begins in the endoplasmic reticulum with the formation of protein-bound primer structures and that these primer structures are extended in the Golgi complex by two putative glucosyltransferases that are functionally redundant, Kre6 and Skn1. This is followed by maturation steps at the cell surface and by coupling to other cell wall macromolecules.
185689	GH16_fungal_KRE6_glucanase	3.40e-158	310	660	1	295	Saccharomyces cerevisiae KRE6 and related glucanses, member of glycosyl hydrolase family 16. KRE6 is a Saccharomyces cerevisiae glucanase that participates in the synthesis of beta-1,6-glucan, a major structural component of the cell wall. It is a golgi membrane protein required for normal beta-1,6-glucan levels in the cell wall. KRE6 is closely realted to laminarinase, a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
225182	BglS	1.32e-50	285	673	26	355	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
185693	GH16_laminarinase_like	1.84e-30	312	659	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185683	Glyco_hydrolase_16	5.63e-07	314	659	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB79960.2|GH16_2	3.80e-189	218	707	91	579
AAW43216.1|GH16_2	6.52e-189	201	707	90	595
AUB24334.1|GH16_2	6.75e-189	196	707	86	596
AFR94645.1|GH16_2	6.75e-189	196	707	86	596
AGV14287.1|GH16_2	6.75e-189	196	707	86	596

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CRQ_A	1.15e-07	308	415	3	103	Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CRQ_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CTE_A Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans],4CTE_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans]
2VY0_A	1.21e-06	304	421	9	132	The X-ray structure of endo-beta-1,3-glucanase from Pyrococcus furiosus [Pyrococcus furiosus],2VY0_B The X-ray structure of endo-beta-1,3-glucanase from Pyrococcus furiosus [Pyrococcus furiosus]
6JH5_A	2.42e-06	308	423	4	113	Structure of Marine bacterial laminarinase [Aquimarina]
6JHJ_A	2.42e-06	308	423	4	113	Structure of Marine bacterial laminarinase mutant-E135A [Aquimarina],6JIA_A Marine bacterial laminarinase mutant E135A complex with laminaritetraose [Aquimarina sp.],6M6P_A Structure of Marine bacterial laminarinase mutant E135A in complex with 1,3-beta-cellotriosyl-glucose [Aquimarina sp.]
2HYK_A	5.94e-06	310	660	9	243	The crystal structure of an endo-beta-1,3-glucanase from alkaliphilic Nocardiopsis sp.strain F96 [Nocardiopsis sp. F96]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32486|KRE6_YEAST	3.43e-137	220	709	244	709	Beta-glucan synthesis-associated protein KRE6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KRE6 PE=1 SV=2
sp|P33336|SKN1_YEAST	5.64e-132	224	709	288	761	Beta-glucan synthesis-associated protein SKN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SKN1 PE=1 SV=1
sp|O13941|YEPB_SCHPO	3.78e-130	288	707	218	623	Uncharacterized beta-glucan synthesis-associated protein C23H3.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC23H3.11c PE=3 SV=1
sp|P87023|KRE6_CANAX	6.24e-129	233	710	283	740	Beta-glucan synthesis-associated protein KRE6 OS=Candida albicans OX=5476 GN=KRE6 PE=2 SV=1
sp|P87024|SKN1_CANAX	1.13e-124	222	710	278	737	Beta-glucan synthesis-associated protein SKN1 OS=Candida albicans OX=5476 GN=SKN1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000015	0.000032

TMHMM  Annotations     

Start	End
230	252