CAZyme Information: PTTG_01500-t43_1-p1

Basic Information

• Species: Puccinia triticina
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia triticina
• CAZyme ID: PTTG_01500-t43_1-p1
• CAZy Family: CE5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
929		103685.87	7.8630

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ptriticina1-1BBBDRace1	15692	630390	814	14878

• Gene Location: location=ADAS02000193.1:23076-28238(+)

Full Sequence      

MSYADPFSDPHYQHDYYDGTAANPRHVEAPITNYGEGDSADDEFLEKDYHQVGLNGQEYP
PEPVSATSFGFPASQVLTDTSAGGKEASARLYRTQTSAEAWGKRQKVNRNRAKTIKVKLS
KGNFVHEYPVPTPIKHANLMGGHIGKDNEFTHMRYTAVTCDPDDFTREAGWSLRPQKYGR
DIELLVAITYYNEDKVLVARTLHGVMLNLKEICKAHWSEFKKMAEKGAPETGAGAAWKKI
AVVLVFDGIEPADKATLDLLATLGVYQDGVMKKEVDGKETQAHVFEYTTMLSVTPKLELI
SPQENDADNLVPVQMTFVLKQKNAKKINSHRWLFNAICPHLEPEVCILLDAGTKPGPRSL
YYLWEAFFHNPNLGGACGEIHAMLSGGKKLLNPLVAAQNFEYKMSNILDKPLESSFGYVS
VLPGAFSAYRTRAIRGRPLQQYFHGDHSLAAKLGDKGVQGMGIFKKNMFLAEDRILCFEL
VAKAKDKWVLGYVKPAKGETDVPESAAELIGQRRRWLNGSFAAGVYALAHFPRMYKTWHN
PIRLLFLHVQAIYTTVGLIMSWFSLANWYVTFAAIIDLVHQFWRDPYAAGGFQANRNTTD
PFKTPGGTSAEKIAWVTMECWSGTILDNTAHFNNPDSVADKYDWLGQLNYALKLVYLALV
SLQIILALGNRPKGEKKAYLISLCIFASFAIYLLTMTLFLTVKAFCPINIQLDEAEASGS
NQASVFMSTSYGPIFAGLAGTFGIYIVSSILYMDPWHLLHSMIPYLFIAVSFTNILNVYA
FCNLHDVSWGTKGSDKAESLPSVSSTTTAKDDGGRVVEDIRRDQSELDADFKETVARAMQ
PLTSVEAVEKPTADDLDKTFRTRFIAIWLLGNAGIIIGIMQSSIDFRTKYFQALLWITFG
LSLVRFLGFGWYLTGAGIFRVARLCARRR

Enzyme Prediction     

EC	2.4.1.16:26	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	190	367	2.2e-66	0.9938650306748467

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133033	Chitin_synth_C	1.68e-90	186	523	1	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
396286	Chitin_synth_1	5.73e-90	190	367	1	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
400626	Chitin_synth_1N	2.53e-33	116	189	1	70	Chitin synthase N-terminal. This is the N-terminal domain of Chitin synthase (pfam01644).
224136	BcsA	2.90e-25	318	589	117	351	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	1.39e-18	310	435	50	167	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABB70409.1|GT2	0.0	53	927	101	974
CDR40400.1|GT2	0.0	53	929	115	958
QRV76364.1|GT2	6.03e-313	56	923	76	864
CAB96110.1|GT2	2.69e-312	2	923	17	894
QRW05268.1|GT2	4.88e-312	56	923	76	864

PDB Hits     

PTTG_01500-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P30598|CHS1_USTMA	3.55e-310	66	908	111	902	Chitin synthase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS1 PE=3 SV=3
sp|J9VMX7|CHS7_CRYNH	4.12e-291	103	912	125	918	Chitin synthase 7 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS7 PE=2 SV=2
sp|Q00757|CHSB_EMENI	4.38e-284	6	918	47	909	Chitin synthase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chsB PE=2 SV=2
sp|P54267|CHSG_ASPFU	1.55e-280	30	918	62	904	Chitin synthase G OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chsG PE=2 SV=2
sp|P30602|CHS3_EXODE	2.59e-280	97	885	115	858	Chitin synthase 3 OS=Exophiala dermatitidis OX=5970 GN=CHS3 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000045	0.000003

TMHMM  Annotations     

Start	End
544	566
650	669
679	701
730	752
762	784
864	883
893	915