CAZyme Information: PTTG_00660-t43_1-p1

Basic Information

• Species: Puccinia triticina
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia triticina
• CAZyme ID: PTTG_00660-t43_1-p1
• CAZy Family: AA5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
576		67680.13	8.8608

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ptriticina1-1BBBDRace1	15692	630390	814	14878

• Gene Location: location=ADAS02000020.1:382254-385048(-)

Full Sequence      

MARHHLIIPPRPHTLLTCLIFLSTLGLLFYLPFMKIRARTCTPAFRRPAQPIFFNTENGL
LVFATPIRNNTKIKHPIESLITNAQVEWDRVLHRQSKTLAMAVQEYQRRNHQRLPPKGFE
KWWQFAVDNQVGLVDEYDQISKDLEPFWAIEPSRLRKLVHQLQTKQNKRRLIFEVDWEGR
VNRTGAFGDSGRAKDLSKLMESYQKYSRKAVKPFTMVIGADDQAEIKTTWRERVRLLELA
KKHKFIDEEEDFQLSETHSPYDDCPPDSAPRSLGKGYSSFVFDHLKSMDICSSLEQVPIH
GSLVNRHSTPFRPITPLFSFSKTLLDSDIRVTPLEQYRTTYGDVYDWDDPRRIGKAFWRG
STTGTLHSNENPSWKDSHRLRLHQLTRATKQHKQLIDGTQVDLAQVNPQWFDIGFVGEPI
QCEPPVCQQLKQMIHFHEWVGDEQANLYKYALDVDGNGWSGRFHKLLASNRVVIKNTIFP
EWYADRIQPWYHYMPVKTDYSDLHDMMHFLKTHDHLAKQIAQNGKDYSEKYWRKQDMAAY
MFRLSLEWSRLYNREICEPGGTKTFCESYDFDLSLL

Enzyme Prediction     

No EC number prediction in PTTG_00660-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	308	552	7.7e-60	0.908

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	2.46e-19	307	551	18	252	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	1.96e-13	303	551	93	322	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR40950.1|GT90	2.39e-115	51	573	145	706
CDR40913.1|GT90	4.28e-102	73	551	240	742
CDR40723.1|GT90	6.35e-99	58	572	198	721
CDR40393.1|GT90	6.03e-92	75	559	114	639
QRV89460.1|GT90	1.78e-88	70	551	128	639

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	9.35e-12	448	561	237	351	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]
5F84_A	4.40e-08	448	556	272	383	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	6.53e-78	73	551	150	655	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|Q6UW63|PLGT2_HUMAN	1.74e-13	314	559	266	471	Protein O-glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=POGLUT2 PE=1 SV=1
sp|Q9JHP7|PLGT2_MOUSE	2.20e-12	308	559	259	471	Protein O-glucosyltransferase 2 OS=Mus musculus OX=10090 GN=Poglut2 PE=1 SV=1
sp|Q5E9Q1|PGLT1_BOVIN	1.87e-11	313	561	143	379	Protein O-glucosyltransferase 1 OS=Bos taurus OX=9913 GN=POGLUT1 PE=2 SV=1
sp|Q7ZVE6|PLGT2_DANRE	2.07e-11	314	551	265	465	Protein O-glucosyltransferase 2 OS=Danio rerio OX=7955 GN=poglut2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000056	0.000001

TMHMM  Annotations     

Start	End
12	34