CAZyme Information: PTTG_00571-t43_1-p1

Basic Information

• Species: Puccinia triticina
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia triticina
• CAZyme ID: PTTG_00571-t43_1-p1
• CAZy Family: AA5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
777		87574.96	6.6785

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ptriticina1-1BBBDRace1	15692	630390	814	14878

• Gene Location: location=ADAS02000002.1:788613-791481(+)

Full Sequence      

MSFSQVPQVDGDLFGPVDNQRKHAVAPLSLFGHGCAHPQSPLHISDGSRHRPIGTNKWYT
QLLLTPNGTDPIYPLPYALAFLDGNSVLSRRAREGSEPLVGLGIIHSTAAQRVFGPPVGQ
QSDSAVRYYYNPVVVSVCLGAKEFSQSNVVPITSDWSELTVQFELSSPANLLPPKSSISF
PVSRGSAFLTALYTALTPTLSSTHTVNSLECVNAGEEHHLFGFRKHRLRYNDGSTWLVYS
LGEQSCFTSHLDLRKITPTDVGHAQAWSGMIQLVKMSDHYERQLGENSHRESEEFVYDNG
IGVWTQAATLRSGPIGTGQYSFDWITNGPRSDCVQPLMFALPHHVEALLDPNIIVRPEIK
IQSRVTGVMRLCRAPRWTFKENVEDLRSYGIKPYHLPNGPPLYDPLKVDLLRQVMVKELD
TDFDAESNLDSYYFSGKKLAKQALQCLTASCVLQDQNMAARFVAKAKKSFDTFRHNRSKA
APLVYEKTWKGIISSSILRTGNRNDDFGNGVYNDHHFHYAYFIHAAAVLVYHDHSYLHSV
RDYVYDLIRDVNNSDESDSYFPLFRNFDWFLGHSMATGLDTSMDGKNQESCSEDANFLYG
VKVWADVTQNPRLGALADLQLSLLKRSVNHYYYMKESDTNAPACFKGNRVPGILFENKAD
YTTFFSNEKDAIHMIQVIPITPITSFMRSPEFIWQEWTNSGSPTENTNQVCQIATKLTNG
YQTLLLTQYGIVDPSYVYNIFVKKLWMCQEIPLDDGLSLSWILGFLINQIELNKLDM

Enzyme Prediction     

EC	3.2.1.39:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	38	764	2.1e-153	0.9903536977491961

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227785	Acf2	2.88e-150	25	765	64	751	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
407548	Glyco_hydro81C	6.41e-143	409	763	8	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
397619	Glyco_hydro_81	5.31e-63	37	382	1	308	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA71911.1|GH81	2.52e-116	37	764	22	709
ATY59065.1|GH81	8.85e-115	38	765	316	1002
ABH10633.1|GH81	1.29e-114	37	765	25	710
NP_594547.1|GH81|3.2.1.39	2.46e-114	36	764	20	697
CAA91245.1|GH81|3.2.1.39	2.46e-114	36	764	20	697

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	5.59e-92	10	763	4	712	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	6.79e-92	4	763	24	737	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	2.16e-88	10	763	4	712	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	4.67e-23	416	776	324	663	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5T49_A	4.76e-13	513	679	461	626	Chain A, BH0236 protein [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	4.37e-115	36	764	20	697	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|D4AZ24|ENG1_ARTBC	1.98e-105	37	765	212	898	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q12168|ENG2_YEAST	3.98e-99	26	765	86	774	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	1.46e-95	25	765	55	733	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q5AIR7|ENG1_CANAL	3.96e-91	11	765	426	1137	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999905	0.000138

TMHMM  Annotations     

There is no transmembrane helices in PTTG_00571-t43_1-p1.