CAZyme Information: PTTG_00467-t43_1-p1

Basic Information

• Species: Puccinia triticina
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia triticina
• CAZyme ID: PTTG_00467-t43_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
999		112209.76	5.5286

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ptriticina1-1BBBDRace1	15692	630390	814	14878

• Gene Location: location=ADAS02000002.1:1903390-1907863(-)

Full Sequence      

MSLPGEFHTWRLPVVSQWTDILQKFAAAGLNTVSIYGKFLRVTLNAHANVHVNANNQCFI
PAETTAGGIPGWVTTLSCPLRTNATDFDKSWRQYWEEMIDRIVPNQVGLPNGTIIGVQVE
NEYLTDAHSSQGQPPGKDQYMQDLADALVDKGIVVPLTVNDAGMDKNYATGMGAVDIYGF
DSYPQSFDCSQPTRWKPVVETYRNYQDSLGLQSPLFIPEFQAGAYDPWGASGYENCRKLT
GPEFESVFYLNNLAANIKMINYYMIYGGTNWGQLAFPGTYTSYDYGAAISEDRTWNEKYT
ELKRQSFFLRSSKEFYETEVVGDSKHDPNYFEGESSCRAFVTELRNPTSGAGFYIVRALN
STSTGPTKFRLNVLTSVGLKQLPQITLSPRESRLLVTDYKTSAGSENPHDPRPIKLLYTT
SSVLLSARIGGHEVIYMFSSGDERISQNIAEAEVSSLKFPSLENDYWMRSFPKASQPPSF
QISTKDSSHGYREIRWRIRDQGAIFALGSQNSVVLMTSKRMAGEVWNPILVQPDSSSPST
SVLIWGPWLVRNATIGTTENPNKNVLCIWGDFEEGLKKEVIIYVGGLIIEGVEWNGKKIR
NLSRAPESNFLSFVYHPNSFKSFMGNKPNSQLSQVGSRIDFRTLNWSYRDSLPEIESKFS
DVKWTEATIEESNNHYKKLYGKYYLYACDYGFCNGATIWRGHFLHNAQMESPMGINLTIA
GGDFFAASLWLNDVFLGSVPNSTSKSDPKFYSKTHMSTFYFPGGSVNKCGSNVITVVQDS
MGMDQTEDGFSDTVKHPRGILGYKLEGPGAEDIFEEISWKVQGHLGGFYKLPDPDRGIYN
ENGFYGIRAGWHLPDYDEPDESQWTALSPMSHGLTTAGIGFYRTTLQLDLEPGYDVIVSF
QFQQPQYDRGRYRIEFWVNGWHMGKFASHLGPQTRFPVHQGILNYQGDNHFALTLWALDE
DGAEISGLELVVDKILEGGIGSIDTHHPPYNSSRLNLFV

Enzyme Prediction     

No EC number prediction in PTTG_00467-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	46	304	1.1e-46	0.752442996742671

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396048	Glyco_hydro_35	1.71e-50	5	304	14	313	Glycosyl hydrolases family 35.
404274	BetaGal_dom4_5	9.10e-33	845	961	1	111	Beta-galactosidase jelly roll domain. This domain is found in beta galactosidase enzymes. It has a jelly roll fold.
402180	BetaGal_dom2	2.13e-21	340	435	20	109	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyzes the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C-terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N-terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, pfam01301, which is N-terminal to it, but itself has no metazoan members.
404274	BetaGal_dom4_5	1.78e-20	685	784	23	111	Beta-galactosidase jelly roll domain. This domain is found in beta galactosidase enzymes. It has a jelly roll fold.
198097	BetaGal_dom2	2.21e-15	340	436	21	111	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyses the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, which is N-terminal to it, but itself has no metazoan members.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW27580.1|GH35	8.82e-207	5	992	58	1001
QRW00634.1|GH35	1.86e-206	5	992	60	1003
QRV86584.1|GH35	1.26e-203	5	992	60	1003
QRW15140.1|GH35	9.86e-203	5	992	60	1003
QRW10069.1|GH35	3.64e-195	5	979	87	1072

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1TG7_A	8.36e-145	1	998	21	971	Native structure of beta-galactosidase from Penicillium sp. [Penicillium sp.],1XC6_A Native Structure Of Beta-Galactosidase from Penicillium sp. in complex with Galactose [Penicillium sp.]
5IFP_A	7.66e-140	1	998	61	1007	Structure Of Beta-galactosidase From Aspergillus Niger [Aspergillus niger CBS 513.88]
3OG2_A	8.45e-140	5	970	45	975	Chain A, Beta-galactosidase [Trichoderma reesei],3OGR_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGS_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGV_A Chain A, Beta-galactosidase [Trichoderma reesei]
4IUG_A	8.86e-140	1	998	61	1005	Crystal structure of beta-galactosidase from Aspergillus oryzae in complex with galactose [Aspergillus oryzae]
5IFT_A	2.09e-139	1	998	61	1007	STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 3-b-Galactopyranosyl glucose [Aspergillus niger CBS 513.88],5IHR_A Structure Of E298q-beta-galactosidase From Aspergillus Niger In Complex With Allolactose [Aspergillus niger CBS 513.88],5JUV_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-b-Galactopyranosyl galactose [Aspergillus niger CBS 513.88],5MGC_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 4-Galactosyl-lactose [Aspergillus niger CBS 513.88],5MGD_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-Galactosyl-lactose [Aspergillus niger CBS 513.88]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DJ58|BGALE_NEOFI	2.18e-150	1	971	57	984	Probable beta-galactosidase E OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=lacE PE=3 SV=1
sp|Q4WG05|BGALE_ASPFU	1.04e-145	1	979	57	992	Probable beta-galactosidase E OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=lacE PE=3 SV=1
sp|B0XXE7|BGALE_ASPFC	1.04e-145	1	979	57	992	Probable beta-galactosidase E OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=lacE PE=3 SV=1
sp|A1D1Z9|BGALA_NEOFI	6.91e-145	1	971	61	979	Probable beta-galactosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=lacA PE=3 SV=1
sp|Q700S9|BGALA_PENSQ	1.15e-143	1	998	61	1011	Beta-galactosidase A OS=Penicillium sp. OX=5081 GN=lacA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999886	0.000176

TMHMM  Annotations     

There is no transmembrane helices in PTTG_00467-t43_1-p1.