CAZyme Information: PTTG_00189-t43_2-p1

Basic Information

• Species: Puccinia triticina
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia triticina
• CAZyme ID: PTTG_00189-t43_2-p1
• CAZy Family: AA2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
425		49374.33	9.7389

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ptriticina1-1BBBDRace1	15692	630390	814	14878

• Gene Location: location=ADAS02000595.1:3016-5020(+)

Full Sequence      

MSDRLKSTGEYFRKIFVAKEQYNLIAGLILLGELLLNAAIINYVRYTEIDWIAYMQQIRG
YSHGERNYLKLKGDTGPLVYPGGFVHVYSALYSLTQQGQEVRLAQYLFGAIYLITMAFVL
AIYKRCESLPTYAIFSLVLSKRLHSIYVLRLFNDGVAMMGLYISIWCLVTRRWNWSALWF
SLALSIKMNILLFFPAFGFVYFQTVGLLKTINLMLIIILVQAWLAIPFLIEFPREYLSKA
FEFKRVFEYQWTVNWRMIPQSDFLSPGFASFLTAVHLSTLVCFAWTKWSRAFGEDGLISL
LVRGLQNWGRPAAKRPNVLTADYIVNVCFTSNLIGIICARTLHYQFYSWYAHQIVFLAWQ
TPYPIFLRILLMMSIEYSWNVFPSTAISSTILLVSNLLLLFGTWWTFEEAYSFVTIAFKK
KPKVT

Enzyme Prediction     

EC	2.4.1.258:18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT58	28	389	5.3e-134	0.9917582417582418

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398745	ALG3	0.0	37	389	11	358	ALG3 protein. The formation of N-glycosidic linkages of glycoproteins involves the ordered assembly of the common Glc3Man9GlcNAc2 core-oligosaccharide on the lipid carrier dolichyl pyrophosphate. Whereas early mannosylation steps occur on the cytoplasmic side of the endoplasmic reticulum with GDP-Man as donor, the final reactions from Man5GlcNAc2-PP-Dol to Man9GlcNAc2-PP-Dol on the lumenal side use Dol-P-Man. ALG3 gene encodes the Dol-P-Man:Man5GlcNAc2-PP-Dol mannosyltransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS08832.1|GT58	9.70e-109	11	409	10	402
QRV98819.1|GT58	5.37e-102	2	416	9	423
QRV84772.1|GT58	5.37e-102	2	416	9	423
QRW13371.1|GT58	1.07e-101	2	416	9	423
QHO44987.1|GT58	8.82e-100	26	404	45	434

PDB Hits     

PTTG_00189-t43_2-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q55F69|ALG3_DICDI	1.13e-98	25	400	21	418	Probable Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Dictyostelium discoideum OX=44689 GN=alg3 PE=3 SV=1
sp|O82244|ALG3_ARATH	1.00e-94	29	404	39	416	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Arabidopsis thaliana OX=3702 GN=ALG3 PE=1 SV=1
sp|Q92685|ALG3_HUMAN	6.22e-90	13	404	32	421	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Homo sapiens OX=9606 GN=ALG3 PE=1 SV=1
sp|Q8K2A8|ALG3_MOUSE	1.75e-89	13	409	32	426	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Mus musculus OX=10090 GN=Alg3 PE=1 SV=2
sp|P82149|NT53_DROME	1.29e-88	11	392	34	473	Lethal(2)neighbour of tid protein 2 OS=Drosophila melanogaster OX=7227 GN=l(2)not2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000048	0.000006

TMHMM  Annotations     

Start	End
22	44
101	123
147	169
179	201
208	230
263	285
323	344
349	371
384	406