CAZyme Information: PTTG_00189-t43_1-p1

Basic Information

• Species: Puccinia triticina
• Lineage: Basidiomycota; Pucciniomycetes; ; Pucciniaceae; Puccinia; Puccinia triticina
• CAZyme ID: PTTG_00189-t43_1-p1
• CAZy Family: AA2
• CAZyme Description: hypothetical protein, variant

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
310		36185.05	9.9365

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ptriticina1-1BBBDRace1	15692	630390	814	14878

• Gene Location: location=ADAS02000595.1:3684-5020(+)

Full Sequence      

MAFVLAIYKRCESLPTYAIFSLVLSKRLHSIYVLRLFNDGVAMMGLYISIWCLVTRRWNW
SALWFSLALSIKMNILLFFPAFGFVYFQTVGLLKTINLMLIIILVQAWLAIPFLIEFPRE
YLSKAFEFKRVFEYQWTVNWRMIPQSDFLSPGFASFLTAVHLSTLVCFAWTKWSRAFGED
GLISLLVRGLQNWGRPAAKRPNVLTADYIVNVCFTSNLIGIICARTLHYQFYSWYAHQIV
FLAWQTPYPIFLRILLMMSIEYSWNVFPSTAISSTILLVSNLLLLFGTWWTFEEAYSFVT
IAFKKKPKVT

Enzyme Prediction     

EC	2.4.1.258:18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT58	2	274	4.5e-89	0.7472527472527473

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398745	ALG3	4.89e-126	1	274	90	358	ALG3 protein. The formation of N-glycosidic linkages of glycoproteins involves the ordered assembly of the common Glc3Man9GlcNAc2 core-oligosaccharide on the lipid carrier dolichyl pyrophosphate. Whereas early mannosylation steps occur on the cytoplasmic side of the endoplasmic reticulum with GDP-Man as donor, the final reactions from Man5GlcNAc2-PP-Dol to Man9GlcNAc2-PP-Dol on the lumenal side use Dol-P-Man. ALG3 gene encodes the Dol-P-Man:Man5GlcNAc2-PP-Dol mannosyltransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA69403.1|GT58	9.47e-77	7	306	115	418
QRW13371.1|GT58	5.02e-75	1	301	128	423
QRV98819.1|GT58	5.02e-75	1	301	128	423
QRV84772.1|GT58	5.02e-75	1	301	128	423
QHO44987.1|GT58	7.91e-69	1	289	133	434

PDB Hits     

PTTG_00189-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q55F69|ALG3_DICDI	2.12e-70	14	285	155	418	Probable Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Dictyostelium discoideum OX=44689 GN=alg3 PE=3 SV=1
sp|O82244|ALG3_ARATH	4.01e-61	1	289	124	416	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Arabidopsis thaliana OX=3702 GN=ALG3 PE=1 SV=1
sp|Q8K2A8|ALG3_MOUSE	3.66e-58	1	294	136	426	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Mus musculus OX=10090 GN=Alg3 PE=1 SV=2
sp|Q92685|ALG3_HUMAN	5.14e-58	8	289	144	421	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Homo sapiens OX=9606 GN=ALG3 PE=1 SV=1
sp|Q9Y7I4|ALG3_SCHPO	7.69e-52	15	276	130	386	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alg3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000027	0.000010

TMHMM  Annotations     

Start	End
32	54
64	86
93	115
148	170
208	229
234	256
269	291