CAZyme Information: PSURA_94673T0-p1

Basic Information

• Species: Phytophthora ramorum
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora ramorum
• CAZyme ID: PSURA_94673T0-p1
• CAZy Family: PL3
• CAZyme Description: UDP-glucose:glycoprotein glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1495		168291.04	5.0569

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PramorumPr-102	15743	N/A	251	15492

• Gene Location: location=PramPr-102_SC0022:185928-190630(+)

Full Sequence      

MLATRTYSVKVETFRQLALDSGVLGGLNTVDELEAILKDKKQQNSEQACVAAGVNDVELQ
VDHKYPHLASDSEETVMSAILYGLVGTEKFHAFHTKLVKQAQKNKIQYMVRHYPHDSPLD
TLLQGYGVALDIKNMEYKTIDDSKKTGEDPAAVDEEGDEEEDEEDEEIDDEEVEGLLFNP
LMARHGAIADDLKQFYDVLVKKADSEQDQELKAWHLKDLGPSAVRAVVDAKNPLKRLETL
SQDFPVQAKKLAFSRKSISTELREEITSSRMHVANRRLKNKFILNGIAVDPLERSFNVFD
FMKTLKEEWSVAKQLGGLPLNQSELEDMLTHVRETNQEQPAVRINMRGSFGGSTPLYLNN
IETDPNSANWSPDVNTLRRPAWNLIFVRKNMYECVLVLDPLSGTGRAALSHIGFMRMRGA
PVQWALLVSSKELMASKTPDGRRVLLETYKAYEVTDKATPWHFAKLLMLAQSKDVAEAGI
ADEENKGSQSDSEEPNEAEEETDRIIPTKIASAFLQRIGEDGSSDVLVGTLLEAYSDAAE
NIGSIPENGKEALACLRSDQFDAEVLAMTDFIHLKHVPLGSFVFNGVVQKNLDIQRSMMA
NFGRDQPLYVNMAHQGKLNDDTDLVEELMTAQDAYPAYLSIFDSSESKIPGDIEVDSPKH
LFADDVDGRLEAAAKPAISYLHAPGSRALAKKQTVIFPVDLNDPRDAGHAYHVVKAVLED
SEQSLRVGIVPQLASGTASKKNNETHLKFLLETLSCVVKGKTVDATKDKLTGIWKKTKIE
EDHKDPAFEKILALLKRKPGKWLTPKQRKVLTQFNTLLRSRFPPAFAEETEDDSAKIALP
ALFINGRQVSLPYQSLSDEDVATIVSFDLKFRSQPVAKALIKRSAALSVKEADNLSFGIM
KTTGIVDKYVKTDRTSHLDVDENSLNTVRLAGDPSLRVAAYVDPLSEAAQVISSMLRMLH
SQLNATVELVLIPADEYTEFPLQRFYRYLFEKKPSLAATSVEFRKLPVQPILTMKIETPE
AWNVQTLHAGDDLDNLRVDPDSPTEVKSTTSAVFRLESLLVYGQCRDTTFNMYSPPNGLQ
LVLEREVGAQLLHRDTLVMKNLGYFQLQATPGVWSLHLARGRAADLFNIVDPDTELPLEN
NPVVVYDFGSHISQLFVHDGALRSYWSSMLNMMGKHDDEAEKKPHDAIAESNQNDSADED
SALAHQKVRTGETIHVFSVASGYLYERFIKIMMSSVLKRTDNPVTFWLLENFLSPDFKRS
IPVLREQFGMDIRLVTYKWPNWLRQQTEKQRIIWGYKILFLDVLFPLGVQKIIYVDADQV
VRADLKELWELDMEGKPYGYTPFCDSRNVGFQFWRQGYWKDHLRGKPYHISALYVVDLAL
FRQMAAGDMLRAVYSQLSADPNSLANLDQDLPNYAQHQIPIFSLPQEWLWCESWCSDETK
ATAKTIDLCNNPKHKEPKLDMAKRVIAGELFNESWIELDQEIKDVEASYTAQAAA

Enzyme Prediction     

EC	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1214	1459	1.6e-122	0.9959677419354839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408203	Glyco_transf_24	0.0	1214	1485	1	268	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
133054	GT8_HUGT1_C_like	8.15e-163	1214	1459	1	248	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
132996	Glyco_transf_8	4.46e-57	1214	1454	1	243	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
408201	Thioredoxin_14	7.20e-24	351	636	9	242	Thioredoxin-like domain. This is the third out of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
408200	Thioredoxin_13	5.16e-21	204	331	2	124	Thioredoxin-like domain. This is the second out of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ20865.1|GT24	0.0	1	1495	105	1666
CCA14500.1|GT24	0.0	2	1491	152	1667
AIG56125.1|GT24	0.0	1	1491	106	1507
AIG55512.1|GT24	0.0	1	1492	104	1518
CAB4116261.1|GT24	2.29e-194	65	1495	187	1565

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NV4_A	2.76e-143	80	1485	164	1447	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5MU1_A	5.22e-143	80	1485	164	1447	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TRT_A	9.89e-143	80	1485	164	1447	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS2_A	9.40e-137	842	1485	550	1213	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5H18_A	1.39e-116	1214	1485	5	272	Crystal structure of catalytic domain of UGGT (UDP-glucose-bound form) from Thermomyces dupontii [Thermomyces dupontii],5Y7F_A Crystal structure of catalytic domain of UGGT (UDP-bound form) from Thermomyces dupontii [Thermomyces dupontii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0WL80|UGGG_ARATH	3.39e-188	65	1487	181	1570	UDP-glucose:glycoprotein glucosyltransferase OS=Arabidopsis thaliana OX=3702 GN=UGGT PE=1 SV=1
sp|Q6P5E4|UGGG1_MOUSE	1.89e-181	2	1489	122	1527	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4
sp|Q9NYU2|UGGG1_HUMAN	1.06e-178	2	1489	122	1527	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3
sp|Q9JLA3|UGGG1_RAT	1.87e-177	2	1489	122	1527	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Uggt1 PE=1 SV=2
sp|Q9NYU1|UGGG2_HUMAN	3.42e-176	5	1485	113	1498	UDP-glucose:glycoprotein glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=UGGT2 PE=1 SV=4

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000057	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PSURA_94673T0-p1.