CAZyme Information: PSURA_94534T0-p1

Basic Information

• Species: Phytophthora ramorum
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora ramorum
• CAZyme ID: PSURA_94534T0-p1
• CAZy Family: PL3
• CAZyme Description: Predicted beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1268		141097.78	5.8215

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PramorumPr-102	15743	N/A	251	15492

• Gene Location: location=PramPr-102_SC0018:552299-557029(+)

Full Sequence      

MWGLRLACIALLAVHCICAIVSTAWVVSLDRWTFRSANGSIRVDKVSVPGTSHVHLMAAG
ILGDPYYRFNEREYQWVARETWVYETQVTLPSDAVQTRATLVFETLDGVAEVAVNGKQVA
TTANSFLSYRIDTGEVLVTGVNHIQVTFQPVTQYARQQADKYPYFVPATENFNTWTEPTR
RSFVRKAGSDFGWDWGPAYVTSGIAGSVHLEMEEQVVKLRNLQVVQVFPGGKEDLSVVDV
TVSVTLDGGKTKHEDVAFELFVNGKKEDALTTTIPEEWADEAAIELSFRLENPRLWWPTG
YGEAYLYDVRVEAWNSNFKSSLSHKSGLRHVELVQDDTTAGDVKGKTFYFKINYVPVFIK
GANWIPTDSFPTRTKTSTVRHLLESVRAANMNMVRVWGGGRYESDLFYSECDRLGILVWQ
ELMFACGMYPRDTTFLQNALQEVAFQVSRLRKYTSIAIWGGNNENENMMEQFVEAPIFPP
GTTFNRDIAVADFTKLFVDLIHPTIVAIDSTRPFVDTSPSNGLYSVDPYVKRWGPTNGIA
FGDVHFYDYNNDCQDYQMYPRARFISEFGFQSWPSAASLRDVSSKEDWGSFQAFWQFLKY
RERHENGTTQMLTQLNRRFHVPFPFRNEKWLSEDISKRIESYLYLTQIQQSLCYQTAIQT
WRRGKNTELGMTMGILYWQLNDIWQGSSWSSIEYSGRWKSLHYVAKREFAPFIISIHQQG
DGKAVQVYGVSDVNEDLHVDVVFELRRTACGTIVKTINRQAIPIAALESRAIEELKIDTF
LDHESTSCHRRSCFLFVRCVTKSVATSTTVAACEDTHHFFAPYKRLNLGWGEVAAHSVVK
TEMDSAVTFSVKLVTSYFAALFVEVDAPGVLGYWSSNSFLMLGNETKTLNFTLASDAEKL
STDAFSRLLTVNWLQKSYDNAVDEAALRSLNDSLVSGSLSRQEYDELLPFLASPTAQPQE
PSDRHSGRNVRFADGVAPEPIQAPPQYSILAPAAMPVTTGLQLRCPACGTSNDTARGSRC
YVCNSRLTVADELSAALTARAYRGRGSSSQRWPRVTAVAPSSGAFSASDDGRVVIHSGFF
SCTMQDTQLIATADAPVVHASPPVDGSQRSATSTSTATSVSSPFPAFTGPAMLPSQPAAP
PMDETELAQAEGAVRLLGQAVHSARGDVRGDGTVQHHLDVCVQLAPGLQRSADLDNPFAN
EELIPRAMQCQEDLQQAVAMYNDALLAVSGVAPVQQQAQPAQHTQQPEPHVQAQPGIQVR
NVVPASAA

Enzyme Prediction     

No EC number prediction in PSURA_94534T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	31	779	1.3e-87	0.6875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	6.41e-75	32	711	19	631	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
407625	Ig_mannosidase	3.55e-09	848	911	14	73	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
407658	Mannosidase_ig	1.36e-05	725	824	3	90	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
236673	ebgA	3.52e-04	81	464	110	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
395572	Glyco_hydro_2	0.002	247	329	29	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA25641.1|GH2	1.24e-255	26	934	59	1007
AIG55460.1|GH2	1.31e-229	28	891	27	842
BDA42312.1|GH2	1.73e-151	32	895	39	901
AAH78052.1|GH2	2.71e-148	31	918	25	874
AAC48665.1|GH2|3.2.1.25	3.56e-144	31	891	28	855

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6DDT_A	3.69e-143	32	906	18	860	mouse beta-mannosidase (MANBA) [Mus musculus],6DDU_A mouse beta-mannosidase bound to beta-D-mannose (MANBA) [Mus musculus]
2VJX_A	4.39e-105	23	892	5	817	Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	4.59e-105	23	892	7	819	Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	4.69e-105	23	892	7	819	Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	1.18e-104	23	892	5	817	Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q95327|MANBA_CAPHI	6.33e-145	31	891	28	855	Beta-mannosidase OS=Capra hircus OX=9925 GN=MANBA PE=1 SV=1
sp|Q29444|MANBA_BOVIN	1.77e-143	31	891	28	855	Beta-mannosidase OS=Bos taurus OX=9913 GN=MANBA PE=1 SV=1
sp|Q8K2I4|MANBA_MOUSE	2.55e-142	32	906	29	871	Beta-mannosidase OS=Mus musculus OX=10090 GN=Manba PE=1 SV=1
sp|O00462|MANBA_HUMAN	9.64e-142	31	891	28	855	Beta-mannosidase OS=Homo sapiens OX=9606 GN=MANBA PE=1 SV=3
sp|Q4FZV0|MANBA_RAT	3.85e-141	31	906	26	873	Beta-mannosidase OS=Rattus norvegicus OX=10116 GN=Manba PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.885596	0.114414

TMHMM  Annotations     

Start	End
7	29