CAZyme Information: PSURA_87159T0-p1

Basic Information

• Species: Phytophthora ramorum
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora ramorum
• CAZyme ID: PSURA_87159T0-p1
• CAZy Family: PL1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
501		55322.19	4.8652

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PramorumPr-102	15743	N/A	251	15492

• Gene Location: location=PramPr-102_SC1621:13-1515(-)

Full Sequence      

MAVTENSPLLQDPSGQPNARPPLRRALYVVVPLALVAVVTICVLVASDGAHKTPAQASTA
APVDVELTNAELLTMRPPFVEKLHPIPPKLVRRNGFGRSLPTNEFWSNLMVGDGHGLNAG
AGEVTLSPYTVRSLPRRLEISYGDSRRVATTDAVTEYFNVDASFTAYSHKTLDGNDTALL
GDGNSTSRNVAGFDALSVLLQYYYQEDNKWMKVPMVRGSPYVTVEYENVLPVLEFNGTVS
AINGKQVQETDPLAPWNELQTWTSNRFELELEVYGTGESAHGTGKSQQKWILYFDKVRTL
QLQFANEKDYRLYNWRGELTTPTNIRLVDTDFYSGAARLAIVPQGAPQAAVEALDKAASI
YPVASSITTDVDDVNASFSFCWKTKRFPDLGEPNLNSTSTAELLMMANPHHAATFKSDSD
AFQVLGQFGHRTLKSNMTAVLGSCWEMQETLPTASFQEEDVQIQPKYLEAIKVALANDSN
YTPEADDPYYFGKEIARQARL

Enzyme Prediction     

No EC number prediction in PSURA_87159T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	84	501	2e-39	0.5112540192926045

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397619	Glyco_hydro_81	2.23e-31	84	453	1	312	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.
227785	Acf2	2.52e-20	52	499	41	441	Endoglucanase Acf2 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ24045.1|GH81	1.91e-271	1	501	1	500
CCA19047.1|GH81	7.93e-104	30	501	28	504
AGP40408.1|GH81	3.96e-25	72	501	53	397
AUX36386.1|GH81	7.22e-25	72	501	64	408
AUX25756.1|GH81	5.60e-24	72	501	71	415

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	8.52e-14	79	501	21	398	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	8.68e-14	79	501	46	423	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	6.04e-13	79	501	21	398	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]

Swiss-Prot Hits     

PSURA_87159T0-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999976	0.000042

TMHMM  Annotations     

Start	End
26	48