CAZyme Information: PSURA_86067T0-p1

Basic Information

• Species: Phytophthora ramorum
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora ramorum
• CAZyme ID: PSURA_86067T0-p1
• CAZy Family: GT71
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
225		24365.24	4.2454

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PramorumPr-102	15743	N/A	251	15492

• Gene Location: location=PramPr-102_SC0445:11937-12614(-)

Full Sequence      

CASTFRITDYAGGCNGAKIRFSPQKDWPVNAGVDKIISALEPVKESYPTLSTADLIVLAG
QVALEDAGNVTIDFLGGRTDAENGNGDEILAPREYYNTTLIAVRDNIRILGVSPYEAVAL
AGRPRSVEQQKALGYSGSYSNNSLTLSNEYFQVLLNETWTEVSAAEYQAEGKNVFMLDTD
LALLAAPELKEAVQLFASEENVFKAVFSSAWAKVMAADHFNATSY

Enzyme Prediction     

No EC number prediction in PSURA_86067T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	2	217	2.3e-25	0.8588235294117647

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173823	plant_peroxidase_like	7.54e-52	1	215	28	254	Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase.
173825	ascorbate_peroxidase	9.56e-36	1	213	40	244	Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water.
223453	KatG	3.95e-34	2	221	476	728	Catalase (peroxidase I) [Inorganic ion transport and metabolism].
173828	catalase_peroxidase_2	4.53e-34	1	218	40	296	C-terminal non-catalytic domain of catalase-peroxidases. This is a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Catalase-peroxidases can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. These enzymes are found in many archaeal and bacterial organisms where they neutralize potentially lethal hydrogen peroxide molecules generated during photosynthesis or stationary phase. Along with related intracellular fungal and plant peroxidases, catalase-peroxidases belong to plant peroxidase superfamily. Unlike the eukaryotic enzymes, they are typically comprised of two homologous domains that probably arose via a single gene duplication event. The heme binding motif is present only in the N-terminal domain; the function of the C-terminal domain is not clear.
237891	PRK15061	5.43e-30	2	220	466	723	catalase/peroxidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPT50360.1|AA0	6.66e-140	1	225	463	687
UIZ20718.1|AA0	4.10e-127	1	225	463	687
UIZ20725.1|AA0	1.64e-126	1	225	463	687
UIZ22874.1|AA2	7.02e-28	2	214	99	322
QPC69144.1|AA2	1.17e-26	6	215	57	275

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5AMM_A	1.16e-23	12	214	47	254	Structure of Leishmania major peroxidase D211N mutant [Leishmania major],5AMM_B Structure of Leishmania major peroxidase D211N mutant [Leishmania major]
3RIW_A	3.21e-23	12	214	48	255	The Crystal Structure of Leishmania major Peroxidase mutant C197T [Leishmania major strain Friedlin],3RIW_B The Crystal Structure of Leishmania major Peroxidase mutant C197T [Leishmania major strain Friedlin]
4GED_A	5.91e-23	12	214	47	254	Crystal Structure of the Leishmania Major Peroxidase-Cytochrome C Complex [Leishmania major]
3RIV_A	6.23e-23	12	214	48	255	The Crystal Structure of Leishmania major Peroxidase [Leishmania major strain Friedlin],3RIV_B The Crystal Structure of Leishmania major Peroxidase [Leishmania major strain Friedlin]
5AL9_A	8.54e-23	12	214	47	254	Structure of Leishmania major peroxidase D211R mutant (high res) [Leishmania major],5ALA_A Structure of Leishmania major peroxidase D211R mutant (low res) [Leishmania major],5ALA_B Structure of Leishmania major peroxidase D211R mutant (low res) [Leishmania major]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59X94|CCPR2_CANAL	6.12e-31	1	215	62	282	Putative heme-binding peroxidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CCP2 PE=3 SV=2
sp|Q4HWQ2|CCPR2_GIBZE	7.85e-27	6	215	57	275	Putative heme-binding peroxidase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=FGRRES_10606 PE=3 SV=1
sp|B0SLJ6|KATG_LEPBP	3.76e-25	2	221	484	739	Catalase-peroxidase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) OX=456481 GN=katG PE=3 SV=1
sp|B0SD19|KATG_LEPBA	3.76e-25	2	221	484	739	Catalase-peroxidase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) OX=355278 GN=katG PE=3 SV=1
sp|B0SX45|KATG_CAUSK	9.42e-25	2	221	477	735	Catalase-peroxidase OS=Caulobacter sp. (strain K31) OX=366602 GN=katG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000055	0.000001

TMHMM  Annotations     

There is no transmembrane helices in PSURA_86067T0-p1.