CAZyme Information: PSURA_85632T0-p1

Basic Information

• Species: Phytophthora ramorum
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora ramorum
• CAZyme ID: PSURA_85632T0-p1
• CAZy Family: GT71
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
534		59476.45	4.5012

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PramorumPr-102	15743	N/A	251	15492

• Gene Location: location=PramPr-102_SC0267:10378-11982(-)

Full Sequence      

MKVQAALAGVLSLAGLASTTSAADPSWHDLAISAPHYGRYLYRTASEEPFFWQADTAWEL
THRLNKTSIDFYLKTRAEQGYNVVQTVVISELNGTTRSNFYGDLPFNNSDPSKPNEAYFE
LVDWTVDLAASYGILIALVPTWGMYVNGGWHSTERIFNESNAYEWGQYIGSRYPGLPKIL
GGDSNALWSWNISEVQAAYAEDPDQDLPALLAPIEDTSAVWASMRRGLKDSEREVGYDSM
ILFHPTNSWIVKPEVTPLPYGHIMLDDEEDRVSVDAVQSGHATPDPTSKFTPAAGWDSTK
NYENIAEMRDKFTGPVLDLENHYEGAHDSFDLTRLIWNASHIRTGLYHGVYEGSTGFTYG
ANSVWQMYEPRSDLLRDSDYYAAQINQNTSGSWRKDIFFEGATQIQYVTKPLSSLSTATL
EQLEPARELLSSPSNHTGKSVNTYEGTRYISILASKDRDRYYVYTGHGDTFSLQLENGSG
NSRSGSATWFSPRDGQYYASSTVSVPASGNGTRVDFTPPSTGGIDNDWLLVVEF

Enzyme Prediction     

No EC number prediction in PSURA_85632T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH140	38	504	7e-78	0.9393203883495146

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404153	DUF4038	6.93e-119	38	415	2	320	Protein of unknown function (DUF4038). A family of putative cellulases.
403955	Collagen_bind_2	1.23e-14	446	533	12	92	Putative collagen-binding domain of a collagenase. This domain is likely to be the collagen-binding domain of a family of bacterial collagenase enzymes. It is the C-terminal part of the Structure 3kzs (information derived from TOPSAN).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KAF2142288.1|GH140	9.34e-175	11	533	8	534
KAF3763706.1|GH140	2.54e-161	13	532	8	535
KNX49908.1|GH140	8.65e-79	38	533	22	518
KAE8156220.1|GH140	4.29e-76	26	533	20	508
KAE8313632.1|GH140	5.18e-73	29	533	26	508

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSY_A	4.39e-22	27	496	13	414	Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_B Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_C Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482]
3KZS_A	3.50e-20	27	496	13	414	Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_B Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_C Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_D Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

PSURA_85632T0-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000306	0.999679	CS pos: 22-23. Pr: 0.9732

TMHMM  Annotations     

There is no transmembrane helices in PSURA_85632T0-p1.