CAZyme Information: PSURA_85625T0-p1

Basic Information

• Species: Phytophthora ramorum
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora ramorum
• CAZyme ID: PSURA_85625T0-p1
• CAZy Family: GT71
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
687	PramPr-102_SC0266|CGC1	71318.84	6.1219

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PramorumPr-102	15743	N/A	251	15492

• Gene Location: location=PramPr-102_SC0266:26764-29324(+)

Full Sequence      

MARNDLRFRTAYCSQRSGHQPADQSIMPQSCEGDVAPKGVWIDHVKVSSVGRQMIVINFS
GATGVTISNCDFDGNTKYSASCDGHHYWGFLILGKRTELSLLGNYIHHTSGRSPKIGGHD
GEISVVHAANNYFYENSGHAFDVATGGYVVAEGNYFASVKTPNLDDPVGNFLVPTAAGDC
QASIGRDCELNVLTDSGTLTGYSQDKVAAQISDVKKTITGYKVAAAAQFSEAKSNFGVDA
SAAKQEAANHPSTTQAAKESKAPATTQPPTTKTPAATEVSTPAPVLTEAPPTQGSLATEI
PDTTAPSTTKTPSTSTDAPDQSQTSSATNAGGVPGFGAGTTGGGSATPVYPKTVKELSTY
LSDAKPRVIVLNQEFTFIDTEGSTTESGCRPTNNQQCLAKKNRFAGQDAILMDGDSAMQQ
TGGCDSGGISVDVTYDNAAKTPLTVASDKTLVGEGTKGVLNGKGLIITGSNVIIQNIHIT
NLNPHLVWGGDGISIGGSGEAPKNIWIDHVKISSVGRHAFDIAAGAYVLAEGNYFSSVKI
PNLDDPAGNFFVPVRESNCKTALGRASSGKLASYSARAALGEVSKYSEVIGGSTVTEATQ
LKEASGNFGVGELVSTIAQPSATGAAKSRNKDAAQASTETEAPVAKEAEVFTKTSGAADA
ESNDVTQSTTQSTETRSIGTCKLRKRH

Enzyme Prediction     

EC	4.2.2.10:1	4.2.2.10:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	38	157	1.5e-49	0.6256684491978609
PL1	433	518	1.8e-34	0.4385026737967914

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	8.00e-17	40	156	71	186	Amb_all domain.
214765	Amb_all	5.65e-16	432	539	1	115	Amb_all domain.
226384	PelB	9.87e-08	426	535	82	195	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	3.71e-05	39	156	89	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.
366158	Pec_lyase_C	7.38e-04	418	539	4	138	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR19253.2|PL1_4	5.13e-131	32	366	195	534
ACR19250.1|PL1_4	9.81e-93	30	277	350	588
ACR19257.1|PL1_4	7.87e-87	331	517	23	210
ACR19256.1|PL1_4	3.84e-80	33	186	193	346
AHX74068.1|PL1_4	2.95e-68	323	613	17	399

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QCX_A	1.17e-39	331	526	5	185	Pectin Lyase B [Aspergillus niger]
1IDK_A	1.28e-37	331	539	5	200	Pectin Lyase A [Aspergillus niger]
1IDJ_A	6.05e-37	331	539	5	200	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CZD4|PELF2_ASPTN	3.49e-47	40	213	184	355	Probable pectin lyase F-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-2 PE=3 SV=1
sp|B8N316|PELF_ASPFN	5.88e-47	40	201	185	345	Probable pectin lyase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelF PE=3 SV=1
sp|Q2UJA7|PELF_ASPOR	5.88e-47	40	201	185	345	Probable pectin lyase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pelF PE=3 SV=2
sp|Q00374|PELA_COLGL	8.04e-44	331	526	26	206	Pectin lyase OS=Colletotrichum gloeosporioides OX=474922 GN=PNLA PE=3 SV=1
sp|A1CFS2|PELA_ASPCL	4.75e-42	331	539	23	218	Probable pectin lyase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=pelA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000083	0.000002

TMHMM  Annotations     

There is no transmembrane helices in PSURA_85625T0-p1.