CAZyme Information: PSURA_83520T0-p1

Basic Information

• Species: Phytophthora ramorum
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora ramorum
• CAZyme ID: PSURA_83520T0-p1
• CAZy Family: GT2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
542	PramPr-102_SC0090|CGC1	60502.24	4.3868

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PramorumPr-102	15743	N/A	251	15492

• Gene Location: location=PramPr-102_SC0090:52116-53744(+)

Full Sequence      

MNLLRRLLPCAAAAIAALLVSSSPAAAEERCFSDDFMFGSATAAYQVEGAYEEGGRTSSI
WDDFCRDKNLSCANVADDFYHRYSSDIKLMADDGLQSFRFSISWSRAMTWNNATRRMEAN
PEGIAFYHDLIDNMLSNNIKPILTLYHWDLPSALQDELTPKGWLSEEIIDHFVDYATLIF
QEFGQKLDFWTTFNEPSSFITAGYGSGAHAPGFTDSEVNTYIVTHNVMRSHAKAVHKFRE
FRDAGVVRSTARIGIVLVAHYSYPLDETNAADVAAAARALEFDYGWYLEPMISGDYPAVM
REVVGDRLPTFTAEESALLKGSYDLFMMNHYASKSVTDCNSTTSQTSCDSLALGYAKDRG
VDDSRAPEGYRNSSRNSAGELNCAWFTAYPPGYLALMKWVSAHDPSAELLLTENGWCGNE
EVENEDQMWYYKNYLEQVYKAVTEESIKVIGYTAWSYLDNYEWGSFEPRFGLYYVDFPSE
IGSPDYVTAEASDLNRIARPAAKWFSQLAKTKCLPEDSSSSSASASTSTSTTEPVVCMDA
GL

Enzyme Prediction     

EC	3.2.1.21:2	3.2.1.23:1	3.2.1.38:1	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	30	512	9.2e-136	0.9883449883449883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395176	Glyco_hydro_1	2.55e-139	32	512	5	451	Glycosyl hydrolase family 1.
274539	BGL	1.97e-120	34	505	2	426	beta-galactosidase.
225343	BglB	3.48e-109	32	517	4	458	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
215435	PLN02814	7.15e-86	32	484	28	469	beta-glucosidase
215455	PLN02849	1.94e-85	32	512	30	483	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EGZ16993.1|GH1	7.45e-240	28	514	28	515
UIZ29641.1|GH1	1.21e-237	31	519	12	501
CCA20215.1|GH1	6.34e-206	30	513	21	505
UIZ29273.1|GH1	2.26e-139	79	514	5	418
VDC69725.1|GH1	4.94e-104	32	512	36	511

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WQ4_A	3.20e-98	32	507	39	503	Crystal structure of beta-primeverosidase [Camellia sinensis],3WQ4_B Crystal structure of beta-primeverosidase [Camellia sinensis],3WQ5_A beta-Primeverosidase in complex with disaccharide substrate-analog N-beta-primeverosylamidine, natural aglycone derivative [Camellia sinensis],3WQ5_B beta-Primeverosidase in complex with disaccharide substrate-analog N-beta-primeverosylamidine, natural aglycone derivative [Camellia sinensis],3WQ6_A beta-Primeverosidase in complex with disaccharide substrate-analog N-beta-primeverosylamidine, artificial aglycone derivative [Camellia sinensis],3WQ6_B beta-Primeverosidase in complex with disaccharide substrate-analog N-beta-primeverosylamidine, artificial aglycone derivative [Camellia sinensis]
2JF6_A	2.78e-96	30	479	41	490	Structure of inactive mutant of Strictosidine Glucosidase in complex with strictosidine [Rauvolfia serpentina],2JF6_B Structure of inactive mutant of Strictosidine Glucosidase in complex with strictosidine [Rauvolfia serpentina],2JF7_A Structure of Strictosidine Glucosidase [Rauvolfia serpentina],2JF7_B Structure of Strictosidine Glucosidase [Rauvolfia serpentina],3ZJ7_A Crystal structure of strictosidine glucosidase in complex with inhibitor-1 [Rauvolfia serpentina],3ZJ7_B Crystal structure of strictosidine glucosidase in complex with inhibitor-1 [Rauvolfia serpentina],3ZJ8_A Crystal structure of strictosidine glucosidase in complex with inhibitor-2 [Rauvolfia serpentina],3ZJ8_B Crystal structure of strictosidine glucosidase in complex with inhibitor-2 [Rauvolfia serpentina]
3GNO_A	7.58e-94	32	511	17	488	Crystal Structure of a Rice Os3BGlu6 Beta-Glucosidase [Oryza sativa Japonica Group],3GNP_A Crystal Structure of a Rice Os3BGlu6 Beta-Glucosidase with Octyl-Beta-D-Thio-Glucoside [Oryza sativa Japonica Group],3GNR_A Crystal Structure of a Rice Os3BGlu6 Beta-Glucosidase with covalently bound 2-deoxy-2-fluoroglucoside to the catalytic nucleophile E396 [Oryza sativa Japonica Group]
4JHO_A	8.22e-94	30	512	36	500	Structural analysis and insights into glycon specificity of the rice GH1 Os7BGlu26 beta-D-mannosidase [Oryza sativa Indica Group],4JIE_A Structural analysis and insights into glycon specificity of the rice GH1 Os7BGlu26 beta-D-mannosidase [Oryza sativa Indica Group]
4RE2_A	8.22e-94	30	512	36	500	Different transition state conformations for the hydrolysis of beta-mannosides and beta-glucosides in the rice Os7BGlu26 family GH1 beta-mannosidase/beta-glucosidase [Oryza sativa Indica Group],4RE3_A Different transition state conformations for the hydrolysis of beta-mannosides and beta-glucosides in the rice Os7BGlu26 family GH1 beta-mannosidase/beta-glucosidase [Oryza sativa Indica Group],4RE4_A Different transition state conformations for the hydrolysis of beta-mannosides and beta-glucosides in the rice Os7BGlu26 family GH1 beta-mannosidase/beta-glucosidase [Oryza sativa Indica Group]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9FLU8|BGL32_ARATH	5.55e-103	32	515	37	515	Beta-glucosidase 32 OS=Arabidopsis thaliana OX=3702 GN=BGLU32 PE=2 SV=2
sp|Q42707|F26G_HELSP	2.42e-102	32	511	96	562	Furostanol glycoside 26-O-beta-glucosidase OS=Hellenia speciosa OX=49577 GN=F26G PE=1 SV=1
sp|Q9FLU9|BGL31_ARATH	1.47e-99	32	515	37	515	Beta-glucosidase 31 OS=Arabidopsis thaliana OX=3702 GN=BGLU31 PE=2 SV=1
sp|Q84YK7|BGL27_ORYSJ	1.19e-98	32	510	29	498	Beta-glucosidase 27 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU27 PE=2 SV=1
sp|Q9M1C9|BGL30_ARATH	5.74e-97	28	518	27	511	Beta-glucosidase 30 OS=Arabidopsis thaliana OX=3702 GN=BGLU30 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000431	0.999524	CS pos: 27-28. Pr: 0.9717

TMHMM  Annotations     

There is no transmembrane helices in PSURA_83520T0-p1.