CAZyme Information: PSURA_83139T0-p1

Basic Information

• Species: Phytophthora ramorum
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora ramorum
• CAZyme ID: PSURA_83139T0-p1
• CAZy Family: GT1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
242		26268.03	4.2835

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PramorumPr-102	15743	N/A	251	15492

• Gene Location: location=PramPr-102_SC0083:102997-103725(-)

Full Sequence      

MKLFIAIAAAAVAVSTASADKEFCGQWNLTQTDDYTIYNNLWGAHDDPKGGQCTGLDSVD
GSTIAWHTSFNWNGTSWQVKSFANAALRFDPVQLADVKSIPSTIEYDYKYDGKIITNVAY
DLFTSATANGTVEYELMVWLAALGGAWPLSSSGKSIKEVNVGNVDFNLYQGKNGNTTVFS
YVAVNTTNSFSADFKQFFDELPEDNTIASTQYLTHMQAGTEPFQGQNATLTVSKYSAAVN
AA

Enzyme Prediction     

EC	3.2.1.151:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH12	91	239	3.2e-42	0.9871794871794872

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396303	Glyco_hydro_12	3.01e-41	35	240	3	207	Glycosyl hydrolase family 12.
235746	PRK06215	2.43e-12	24	195	41	193	hypothetical protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABB22034.1|GH12	1.77e-177	1	242	1	242
ABB22025.1|GH12	5.63e-147	1	242	1	243
ABG91065.1|GH12	1.41e-140	5	240	7	242
ABB22026.1|GH12	8.42e-122	9	242	11	243
ABB22033.1|GH12	4.67e-118	1	239	1	239

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VLB_B	4.71e-76	22	239	6	221	Crystal structure of xeg-edgp [Aspergillus aculeatus],3VLB_D Crystal structure of xeg-edgp [Aspergillus aculeatus]
3VL8_A	5.91e-76	22	239	13	228	Crystal structure of XEG [Aspergillus aculeatus],3VL9_A Crystal structure of xeg-xyloglucan [Aspergillus aculeatus],3VL9_B Crystal structure of xeg-xyloglucan [Aspergillus aculeatus]
4NPR_A	2.82e-72	22	239	26	242	Crystal Structure of the Family 12 Xyloglucanase from Aspergillus niveus [Aspergillus niveus],4NPR_B Crystal Structure of the Family 12 Xyloglucanase from Aspergillus niveus [Aspergillus niveus]
6K9D_A	3.68e-48	24	240	4	218	Chain A, GH12 beta-1, 4-endoglucanase [Aspergillus fischeri]
6K98_A	8.53e-47	24	240	5	219	Chain A, GH12 beta-1, 4-endoglucanase [Aspergillus fischeri]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|W2PDG1|XLP1_PHYPN	2.60e-88	1	240	1	238	Inactive glycoside hydrolase XLP1 OS=Phytophthora parasitica (strain INRA-310) OX=761204 GN=XLP1 PE=1 SV=1
sp|Q5BG78|XGEA_EMENI	1.93e-83	1	240	1	239	Xyloglucan-specific endo-beta-1,4-glucanase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xgeA PE=1 SV=1
sp|G4ZHR2|XEG1_PHYSP	5.87e-83	1	240	1	241	Xyloglucan-specific endo-beta-1,4-glucanase 1 OS=Phytophthora sojae (strain P6497) OX=1094619 GN=XEG1 PE=1 SV=1
sp|W2PEP3|XEG1_PHYPN	1.18e-82	7	240	9	241	Xyloglucan-specific endo-beta-1,4-glucanase 1 OS=Phytophthora parasitica (strain INRA-310) OX=761204 GN=XEG1 PE=1 SV=1
sp|B8N3L3|XGEA_ASPFN	6.55e-82	22	239	23	239	Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=xgeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000207	0.999746	CS pos: 19-20. Pr: 0.9753

TMHMM  Annotations     

There is no transmembrane helices in PSURA_83139T0-p1.