CAZyme Information: PSURA_83132T0-p1

Basic Information

• Species: Phytophthora ramorum
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora ramorum
• CAZyme ID: PSURA_83132T0-p1
• CAZy Family: GH89
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
356		39708.09	6.1628

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PramorumPr-102	15743	N/A	251	15492

• Gene Location: location=PramPr-102_SC0083:79802-81018(+)

Full Sequence      

MNAVIALMLGATSLAVALADPRVMIESTYTDTKGLNDLAQEAMGIKYMGTATGIKQLRDA
HYTQELNNTHDFGAITPTNAMKWDETEPEQDVFTFAEADKIIAFANTTGSMVRCSPLVSH
KQVPAWVKVLEKADMLKAMSNHITKLMTHFGNTCIAWDVVSEAIEEDGSYRQSFWYKKAG
EDYLLTAYETANTVKADLGLKARLFYNDYDINVINNKSDAVLAMAQKFRRKKLWVEGIGF
QSHYGNNDSVAGADIFWNFRRFTTIHMDVAVTELDVKTSMANPTVSEQRQQVGIYTNVVS
ACKKTKRCLGVTIWDFVDGYSTTNSSAPLPFYQPDGPNTPLVRKATYDAITAGWIY

Enzyme Prediction     

EC	3.2.1.8:31

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	44	333	1.8e-73	0.9207920792079208

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395262	Glyco_hydro_10	4.39e-89	35	350	1	308	Glycosyl hydrolase family 10.
214750	Glyco_10	1.12e-75	81	350	1	263	Glycosyl hydrolase family 10.
226217	XynA	1.42e-61	33	334	21	330	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOV63057.1|GH10	1.21e-195	1	356	1	355
AOV63056.1|GH10	8.09e-195	1	355	1	358
UIZ28775.1|GH10	3.40e-172	1	355	2	355
UIZ24493.1|GH10	3.97e-166	1	355	2	353
AOV63055.1|GH10	1.21e-122	12	354	8	350

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XZO_A	2.15e-78	34	348	2	327	Chain A, Beta-xylanase [Bispora sp. MEY-1],5XZO_B Chain B, Beta-xylanase [Bispora sp. MEY-1],5XZU_A Chain A, Beta-xylanase [Bispora sp. MEY-1],5XZU_B Chain B, Beta-xylanase [Bispora sp. MEY-1]
6JDT_A	5.99e-74	34	353	2	316	Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDT_B Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDY_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDY_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDZ_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JDZ_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JE0_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE0_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE1_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE1_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE2_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5],6JE2_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5]
3WUF_A	9.88e-68	31	352	1	310	The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) from Streptomyces sp. 9 [Streptomyces sp.],3WUG_A The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]
3WUB_A	3.10e-66	31	352	1	310	The wild type crystal structure of b-1,4-Xylanase (XynAS9) from Streptomyces sp. 9 [Streptomyces sp.],3WUE_A The wild type crystal structure of b-1,4-Xylanase (XynAS9) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]
6Q8M_A	1.46e-65	37	353	26	338	GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8M_B GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8N_A GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872],6Q8N_B GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B4XVN1|XYNA_STRSQ	8.86e-64	31	352	39	348	Endo-1,4-beta-xylanase A OS=Streptomyces sp. OX=1931 GN=xynAS9 PE=1 SV=1
sp|O60206|XLNA_AGABI	3.35e-60	35	354	19	331	Endo-1,4-beta-xylanase OS=Agaricus bisporus OX=5341 GN=xlnA PE=2 SV=1
sp|Q5ZNB1|XYND_TALFU	4.65e-59	39	321	24	302	Endo-1,4-beta-xylanase D OS=Talaromyces funiculosus OX=28572 GN=xynD PE=1 SV=1
sp|Q8J1Y4|XYN5_MAGGR	2.63e-57	30	328	33	328	Endo-1,4-beta-xylanase 5 OS=Magnaporthe grisea OX=148305 GN=XYL5 PE=3 SV=1
sp|G4MLU0|XYN5_MAGO7	2.63e-57	30	328	33	328	Endo-1,4-beta-xylanase 5 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=XYL5 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000210	0.999772	CS pos: 19-20. Pr: 0.9438

TMHMM  Annotations     

There is no transmembrane helices in PSURA_83132T0-p1.