CAZyme Information: PSURA_83050T0-p1

Basic Information

• Species: Phytophthora ramorum
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora ramorum
• CAZyme ID: PSURA_83050T0-p1
• CAZy Family: GH85
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
401	PramPr-102_SC0082|CGC1	43377.81	4.8257

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PramorumPr-102	15743	N/A	251	15492

• Gene Location: location=PramPr-102_SC0082:24932-26137(+)

Full Sequence      

MRSFPIFHLVAVAIATVTTAADLPYSTRMIESVVSREQGVVSSGAVTSTLESGILTLAIQ
SWLNTYSKDGDSERVANFTTYADSIVASISPSFKGPSAAAKMPLDRFTIGQALLDINATQ
GSLTTAEAETLTTLISSLVLQNRNQYNGFWYYVYPYWSYLDGAVSFLPYMAAAPGWSYED
MLSQIELLYNNTYDNTTALAVHGYDASKTAVWANKATGASPYVWGRSLGWYLAGLVNAWE
QLGDCHGGSNADCVRLASAIQLQASQLCESIVTYADTDTGVWWQLPTFGGKQGNFLESSS
TMLYTFAILKGLRLGLLKDNATSAHGLQTAAMRAYNYTVTKGTFLLDYGNGTLGWNGTVA
VCSLNSTATYEYYVGRPIVHNHALGEGAFILASLEVEQVAK

Enzyme Prediction     

No EC number prediction in PSURA_83050T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	58	398	2.6e-46	0.9397590361445783

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	1.03e-26	136	400	109	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	1.20e-23	141	397	108	340	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ26402.1|GH105	6.94e-210	1	400	1	402
UQC88631.1|GH105	1.05e-112	29	398	1	359
QLI74420.1|GH105	1.06e-109	1	400	1	391
QLI72757.1|GH105	1.81e-107	26	400	12	378
UNI22131.1|GH105	1.47e-105	24	399	27	400

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	5.52e-34	143	397	111	359	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	8.55e-31	128	397	112	365	Structure of Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	3.62e-30	128	397	102	355	Chain A, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O34559|URHG2_BACSU	4.40e-30	128	397	112	365	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	5.60e-19	179	395	20	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	5.60e-19	179	395	20	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000256	0.999698	CS pos: 20-21. Pr: 0.9782

TMHMM  Annotations     

There is no transmembrane helices in PSURA_83050T0-p1.