CAZyme Information: PSURA_81952T0-p1

Basic Information

• Species: Phytophthora ramorum
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora ramorum
• CAZyme ID: PSURA_81952T0-p1
• CAZy Family: GH72
• CAZyme Description: Chitinase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
411	PramPr-102_SC0066|CGC1	46301.59	5.4770

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PramorumPr-102	15743	N/A	251	15492

• Gene Location: location=PramPr-102_SC0066:88664-90153(+)

Full Sequence      

MLRLPPTRLPIAVTLLSLLLAWECGARAVPVYDAKGLFVDRLTHDDRARLHACPCSSNEL
ENAASLCLPVDFAGKRPQKEIFAFSVATDERWKHYDWDQLTTVAWNEDKELLCHAHSKGV
KVVVKHNFDDVDQLCNVTARQEWIKETYSKIVENYADGVNIDTEKPMYGRTSQCLGALVR
ELRQELEQHALTKNAQITFDVPWAPRGVDGRYYPWRELADATDFLFVMSYDMRSQVYDAC
VAGANAPLALVRQGLEEFLLGVGVAPDKLVLGVPWYGYQYPCLEGEQPIDGAASWCQIRP
VAFFGAPCSDAAGGQIDYGDIRRLVKSHGLIEQWDPLTETPFVWYSSPNKGSSRRVQLWF
DNPRSLKGKYRLARELGLRGVGMWNADTLDYAANNSDTRLMWSALGEAFVS

Enzyme Prediction     

EC	3.2.1.-:18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	81	388	2.5e-40	0.8108108108108109

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119354	GH18_chitobiase	1.51e-115	52	405	18	358	Chitobiase (also known as di-N-acetylchitobiase) is a lysosomal glycosidase that hydrolyzes the reducing-end N-acetylglucosamine from the chitobiose core of oligosaccharides during the ordered degradation of asparagine-linked glycoproteins in eukaryotes. Chitobiase can only do so if the asparagine that joins the oligosaccharide to protein is previously removed by a glycosylasparaginase. Chitobiase is therefore the final step in the lysosomal degradation of the protein/carbohydrate linkage component of asparagine-linked glycoproteins. The catalytic domain of chitobiase is an eight-stranded alpha/beta barrel fold similar to that of other family 18 glycosyl hydrolases such as hevamine and chitotriosidase.
214753	Glyco_18	1.64e-36	136	388	88	333	Glyco_18 domain.
395573	Glyco_hydro_18	7.97e-29	81	387	27	305	Glycosyl hydrolases family 18.
119353	GH18_CFLE_spore_hydrolase	1.67e-25	115	384	54	300	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
226376	YaaH	1.78e-17	134	384	186	405	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ27644.1|GH18	1.23e-207	18	411	432	839
CCA16750.1|GH18	5.26e-137	46	404	28	380
CCA27450.1|GH18	1.12e-136	50	404	3	351
AIG55971.1|GH18	2.22e-120	46	411	20	387
AAA40924.1|GH18|3.2.1.-	7.52e-84	39	405	18	363

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JM7_A	7.61e-14	140	391	102	352	Crystal structure of Ostrinia furnacalis Group IV chitinase [Ostrinia furnacalis],6JMB_A Chain A, ofchtiv-allosamidin [Ostrinia furnacalis]
6JM8_A	7.77e-13	140	391	102	352	Crystal structure of Ostrinia furnacalis Group IV chitinase [Ostrinia furnacalis]
5XWF_A	9.83e-12	68	390	13	356	Chain A, Fungal chitinase from Rhizomucor miehei (SeMet-substituted proteins) [Rhizomucor miehei]
6KXN_A	3.04e-09	132	384	93	352	Crystal structure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXN_B Crystal structure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6KST_A	3.04e-09	132	384	93	352	Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KST_B Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KXL_A Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXL_B Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q01460|DIAC_RAT	1.34e-84	39	405	18	363	Di-N-acetylchitobiase OS=Rattus norvegicus OX=10116 GN=Ctbs PE=1 SV=1
sp|Q8R242|DIAC_MOUSE	1.45e-83	48	405	18	362	Di-N-acetylchitobiase OS=Mus musculus OX=10090 GN=Ctbs PE=1 SV=2
sp|Q01459|DIAC_HUMAN	4.90e-77	53	405	41	378	Di-N-acetylchitobiase OS=Homo sapiens OX=9606 GN=CTBS PE=1 SV=1
sp|Q8T293|DIAC2_DICDI	7.16e-66	53	409	26	374	Probable di-N-acetylchitobiase 2 OS=Dictyostelium discoideum OX=44689 GN=ctbs2 PE=3 SV=1
sp|Q7KWW8|DIAC1_DICDI	2.39e-59	53	409	23	370	Probable di-N-acetylchitobiase 1 OS=Dictyostelium discoideum OX=44689 GN=ctbs1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000220	0.999762	CS pos: 28-29. Pr: 0.6686

TMHMM  Annotations     

There is no transmembrane helices in PSURA_81952T0-p1.