CAZyme Information: PSURA_81662T0-p1

Basic Information

• Species: Phytophthora ramorum
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora ramorum
• CAZyme ID: PSURA_81662T0-p1
• CAZy Family: GH7
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1293	PramPr-102_SC0062|CGC1	140730.75	6.0441

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PramorumPr-102	15743	N/A	251	15492

• Gene Location: location=PramPr-102_SC0062:131422-135303(+)

Full Sequence      

MGDEVASSSGLHVAASPPAPPTSGVLSPRNEFFVSQRAATDFELSRLDTLSLEEQEILAN
IQELQLQLMKLRAEEEEDSDEESTDKATTTADSQLIVVSNNLPVLLERQPQTGRWKATKT
TGGLDKLMCLTGVRAEMNFLWVGWVGQHIPKSEHEAVRRLLLQHNCLPVFLSSDVASRHT
GFSSEVLWSLFHYVSEPVPSTWNAGGNSSFHSTKRFNKQDWRAYESANESFADAIAEIYN
EGDSVWVHDYHLMLLPSLLRQRIPLCRIGWFLHTPFPASDVYCRLPVRSQLLTGVLQADL
IGFQTFDYERHFLSTCHRLLGVECSHKGVRSTLADRDHFTSIGVFPIGISLEPFARAASS
LPTLNRVNELHDKFGGKRIILGIDRLDNIKGLPHKMLAMEMLLDRFPEWQHNVVLVQIGI
SSRSGVVDSKSTGAGDNSRRTSASSASGDSANILPRSSSYPIGGSSSGNDSPIKALSESP
PSAASPIATGKGNIGYDACHQLEMSSQSYHNIVTQVNQIVGRINGIFGTLDYAPIHFIQQ
QATPHEELCALYDLADVCLVTSTRDGMNLVSHEFIVCQQHFMRNKDERKKAARAAARGFS
ASSLSGGGGTAPKPGIPNSPETIGEGVGVMKGGVLSPITSPRQSSASMLTDWEGEDGGPG
VLVVSEFAGCSQSLSGAIVVNPWNTEDVALSIHQALSMCRTEREIRQQKLYRYVSSNTAS
AWGEEFLEELGVAVEKNRKSSTQLPKLDKKSIVQAYRSSQNRVIILDYDRTLTPQHSLLP
LAAVGPNFKSLLDALSADERNTVFIVSGRERKFLETWLNGVRVGVAAEDGFFYRMNLSNT
REQWKTMSKFQYDVATARSGGSTTATVVGVGSASGGSLDASYSGDAHSMMHMSMGSLPAY
SQHASAPGSTDTGDGTPRAVGSIAPTDDSFGGDDMSWKDLVLPTMLMFTDRTPGSYIEDK
ESSLTWHYGDADPHFGSWQAKDLQIILERQLIGTALEVYQGHKSVSVEHEGCTKTRVLEG
ILKHLSLGEQISKKSDQEVDFVLCVCDDVTDDQMFQTLNALVAESNERHDERKRKEEEQA
ANERIRRNSIAMGKPLPPQLHAQPVPSAAHVSKAKPRMPRPRGGSGVTDELEPAKKVRNG
LKKRRQNEQLLGTAAAAVRGHEDYSTDDDELDDGECVDDDNKVAFSRLQKVPVRLAENVS
IFAVVVGPDVQHSGGRHACSFAVDSLADVRKVLKDFVDESRKGGSATGPIAAGRGATAPN
ANASAPPAPVKSGEDSDVASQTPDHELNPPSPP

Enzyme Prediction     

EC	2.4.1.15:146

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	85	429	1.2e-108	0.6842105263157895

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
184712	PRK14501	0.0	93	1058	1	690	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
340820	GT20_TPS	1.40e-174	94	730	1	462	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
395781	Glyco_transf_20	9.06e-166	93	730	1	468	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
215556	PLN03064	2.36e-165	94	1045	95	796	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
215555	PLN03063	6.09e-160	94	1045	12	706	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29831.1|GT20	0.0	8	1250	5	1219
CCA23376.1|GT20	0.0	22	1240	474	1629
CCA20339.1|GT20	4.74e-184	21	1055	15	795
CCA16456.1|GT20	1.03e-180	50	1055	127	878
QOX06485.1|GT20	1.32e-165	54	1062	19	781

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HVO_A	8.59e-109	92	730	10	474	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HVM_A	1.34e-108	88	730	7	474	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
6JBI_A	1.46e-107	94	730	1	462	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HUT_A	3.03e-107	94	730	5	467	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]
5HUV_A	1.12e-106	94	730	5	467	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54K57|TPSA_DICDI	7.36e-151	89	1007	12	659	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum OX=44689 GN=tpsA PE=2 SV=1
sp|Q9SYM4|TPS1_ARATH	2.33e-128	94	1045	93	794	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 OS=Arabidopsis thaliana OX=3702 GN=TPS1 PE=1 SV=1
sp|Q9FZ57|TPS2_ARATH	2.22e-123	94	1044	13	707	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 2 OS=Arabidopsis thaliana OX=3702 GN=TPS2 PE=3 SV=1
sp|Q0WUI9|TPS8_ARATH	1.92e-121	84	1062	45	794	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 8 OS=Arabidopsis thaliana OX=3702 GN=TPS8 PE=2 SV=1
sp|Q9LMI0|TPS7_ARATH	4.54e-121	84	1058	50	789	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 7 OS=Arabidopsis thaliana OX=3702 GN=TPS7 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000073	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PSURA_81662T0-p1.