CAZyme Information: PSURA_81354T0-p1

Basic Information

• Species: Phytophthora ramorum
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora ramorum
• CAZyme ID: PSURA_81354T0-p1
• CAZy Family: GH5
• CAZyme Description: Predicted endo-1,3-beta-glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
795		88166.91	4.5759

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PramorumPr-102	15743	N/A	251	15492

• Gene Location: location=PramPr-102_SC0059:91947-94334(+)

Full Sequence      

MKVLALLQVGVLAVTARRVVASLTDPDVGDGYNFLDGTVKSATEKLVGTLSPSTPTASSS
TQQTSSSGGFFAAFGTDGPSEELFERNGSLEKIVPIINVAKEALSLPIPTNDWWGNLIHV
TDLKNVSNYAAWSNPYAVKLPREAPYGLQTCYSYTYREIAPEINGTVKYYNHSYHNDLTL
SSEEFFMYEPTYEVYEWAAGGAKLRTCDEASGKCMDSALVSGMAFVSAKYDGLTPRIDTE
HDITAVDDSAPGKFVIHLNNSQTWVLYASDKSISFRVEDSVVFSVNASGSSLVADAGYSG
TIRVALLPDDADDTVYDEFASCMVLGGSVSMESRTGYSLHWATEGNTCDTVGLLHFALPH
QVESLSGSPTTAGSQGAIVMHSATRGVMVGQVTTNPTWSFVEPEADFEVDFYPVRKPSPW
IVLETDMLRTLQKDIIANWSDWNANSWYYNGKYFQKYASLCLMAADSSVVGPDTTLLSYC
LEKLENMIEPVLNNTLSPPLMYDTLYRGLISSSIFQTGSIYTEFGNGMYNDHHYHYGYFV
TASAILKHLDPNWSRMPELEKVIWTMLRDVANPSADDTYFPRFRHFSWYLGHSYSHGVTS
IDNGKDEESTSEDINFFYGMTLWGRVTGNKAVEDLGSLMLRLDAHAIRTYFLMTSDNTVH
PPAIVRNHVTGIFFDNKVYYNTWFLDEKYAIHGIQMIPVSPINQLARTSTFVEQEWNDIL
SKEPIVIEVNTTITWLSLLLVNAATVNPIESLHNLKNATMDDGLSRSWALYNAATRCRDD
VDVNVTAAVQLTVAV

Enzyme Prediction     

No EC number prediction in PSURA_81354T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	99	771	1.1e-164	0.9807073954983923

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	3.39e-125	443	770	27	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	3.04e-124	107	774	89	753	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	2.36e-47	107	413	14	318	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ26137.1|GH81	0.0	69	776	121	824
UIZ26602.1|GH81	0.0	69	776	121	824
UIZ26131.1|GH81	0.0	69	776	11	714
UIZ26438.1|GH81	0.0	68	776	42	740
UIZ26440.1|GH81	0.0	68	776	42	740

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	5.82e-94	177	776	114	718	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	9.94e-94	177	776	139	743	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	6.12e-89	177	776	114	718	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	4.55e-26	530	720	414	603	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	1.79e-20	530	764	439	667	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	5.20e-92	107	774	34	700	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	1.35e-83	215	774	183	735	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q5AIR7|ENG1_CANAL	7.23e-79	67	774	425	1139	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1
sp|D4AZ24|ENG1_ARTBC	4.83e-76	219	774	342	900	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|P53753|ENG1_YEAST	1.38e-75	211	770	535	1106	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000592	0.999376	CS pos: 21-22. Pr: 0.9518

TMHMM  Annotations     

There is no transmembrane helices in PSURA_81354T0-p1.