CAZyme Information: PSURA_79718T0-p1

Basic Information

• Species: Phytophthora ramorum
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora ramorum
• CAZyme ID: PSURA_79718T0-p1
• CAZy Family: GH43
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
348	PramPr-102_SC0042|CGC1	37495.79	6.1012

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PramorumPr-102	15743	N/A	251	15492

• Gene Location: location=PramPr-102_SC0042:416700-417746(-)

Full Sequence      

MHTFALPLLALASLATSTLAAIDCTSNGANARTQPPSGAVVVDASGAYKGSYQTVSEGVA
NIPNTTAEHTLFVFPGVYHEQVIVPKFNGPLVLQGYTCDTKSYADNQVTVTHTMAQRDLP
ANTTGALNALVSTMLFKSRNGVKVYNLNIANPTGKIKQLGQAVATYVDNTDYGFYACNFT
GYQDTLCANKGKELYARSYIAGAVDFVFGLQSKAWFESCDIESVGKGSITANGNGNSSNL
SEYVFNNARVFGALGNGTAYLGRPWYPYARVVWQNSNLSDVINPQGWQTWNKDNNTGNVY
FKEFNNVGAGAATDERVAFGGQLTASVDITEILGKDYKSNWWVDASFL

Enzyme Prediction     

EC	3.1.1.11:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	40	324	6.1e-68	0.9409722222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178372	PLN02773	1.74e-43	34	324	1	283	pectinesterase
178113	PLN02497	5.18e-43	40	326	34	309	probable pectinesterase
178051	PLN02432	7.88e-42	40	337	13	285	putative pectinesterase
215117	PLN02176	1.38e-38	40	319	41	309	putative pectinesterase
395871	Pectinesterase	8.52e-38	40	321	2	276	Pectinesterase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACO54875.1|CE8	2.61e-188	10	348	6	346
ACO54870.1|CE8	4.23e-171	1	348	1	347
ACO54874.1|CE8	1.46e-169	6	348	6	348
ACO54872.1|CE8|3.1.1.11	1.19e-168	1	348	1	348
ABQ63096.1|CE8	1.30e-162	1	348	1	344

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	4.79e-59	32	347	3	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	6.75e-59	32	347	3	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1GQ8_A	1.17e-30	40	321	9	283	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	7.09e-25	50	321	13	279	Chain A, Pectinesterase 1 [Solanum lycopersicum]
4PMH_A	1.17e-07	52	311	48	366	The structure of rice weevil pectin methyl esterase [Sitophilus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12535|PME_ASPAC	8.58e-74	29	347	17	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|P17872|PME_ASPNG	3.83e-72	29	348	17	330	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|B8NPS7|PMEA_ASPFN	1.14e-59	32	347	28	324	Probable pectinesterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pmeA PE=3 SV=1
sp|Q2UBD9|PMEA_ASPOR	1.61e-59	32	347	28	324	Probable pectinesterase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pmeA PE=3 SV=1
sp|A1DBT4|PMEA_NEOFI	6.35e-59	32	347	28	324	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000210	0.999755	CS pos: 20-21. Pr: 0.9770

TMHMM  Annotations     

There is no transmembrane helices in PSURA_79718T0-p1.