CAZyme Information: PSURA_78803T0-p1

Basic Information

• Species: Phytophthora ramorum
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora ramorum
• CAZyme ID: PSURA_78803T0-p1
• CAZy Family: GH32
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
384		42286.57	5.2510

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PramorumPr-102	15743	N/A	251	15492

• Gene Location: location=PramPr-102_SC0034:464445-465860(+)

Full Sequence      

MKVLANVVALVSLAIQATTAGFVKTSGTAFEVDGEPFYIFGTNSYWASEINWLLREQSET
DLAAIFTTMAQNDITVCRSMGFADLTTVGTTPYNIVYQLWENGVASINTKDNGLGYFDKV
VAAAKAAGVKLVVPLVNNWSDYGGMDVYVKQLGGKYHDDFYTDAKIKAAYKKYIATFVKR
YKENDTIMSWELCNECRCAGSGGGMPESGTCTTKTINDWMTEMSAYIKSLDSNHLVATGS
EGFMNTDSSVYLYSGLSGVDFDANLAIKSIDYGAYHTYPDGWSVDASEFVSWGRKWINDH
VASGKKAGKPVVMEEYGVKSHNASVYKAWSDAVYAAGSSMQYWEFGLESLKTYRGDYTIY
DTDEIFKSTIVPAAKKFKARRGSA

Enzyme Prediction     

EC	3.2.1.78:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	61	345	1.2e-82	0.9896193771626297

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226444	COG3934	1.18e-32	131	338	83	270	Endo-1,4-beta-mannosidase [Carbohydrate transport and metabolism].
395098	Cellulase	6.26e-11	152	343	88	266	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW08259.1|CBM1|GH5_7	3.89e-106	19	376	97	447
EPQ57046.1|GH5_7|3.2.1.78	2.06e-102	10	366	15	365
QRV79394.1|CBM1|GH5_7	1.02e-100	19	376	97	447
ABB88954.1|CBM1|GH5_7|3.2.1.78	6.98e-100	18	366	89	431
ABG79370.1|CBM1|GH5_7|3.2.1.78	1.55e-99	21	380	102	459

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4AWE_A	1.26e-83	21	376	5	380	The Crystal Structure of Chrysonilia sitophila endo-beta-D-1,4- mannanase [Neurospora sitophila]
4QP0_A	4.32e-80	20	333	2	313	Crystal Structure Analysis of the Endo-1,4-beta-mannanase from Rhizomucor miehei [Rhizomucor miehei]
3PZ9_A	2.88e-71	32	361	22	361	Native structure of endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3PZG_A I222 crystal form of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3PZI_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 in complex with beta-D-glucose [Thermotoga petrophila RKU-1],3PZM_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with three glycerol molecules [Thermotoga petrophila RKU-1],3PZN_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with citrate and glycerol [Thermotoga petrophila RKU-1],3PZO_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 in complex with three maltose molecules [Thermotoga petrophila RKU-1],3PZQ_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with maltose and glycerol [Thermotoga petrophila RKU-1]
3WH9_A	8.53e-70	22	346	2	309	The ligand-free structure of ManBK from Aspergillus niger BK01 [Aspergillus niger],3WH9_B The ligand-free structure of ManBK from Aspergillus niger BK01 [Aspergillus niger]
1QNO_A	4.62e-69	20	346	2	309	Chain A, ENDO-1,4-B-D-MANNANASE [Trichoderma reesei],1QNP_A Chain A, Endo-1,4-b-d-mannanase [Trichoderma reesei],1QNQ_A Chain A, Endo-1,4-b-d-mannanase [Trichoderma reesei],1QNR_A Chain A, Endo-1,4-b-d-mannanase [Trichoderma reesei],1QNS_A Chain A, Endo-1,4-b-d-mannanase [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AZ53|MANC_EMENI	1.85e-85	10	317	6	315	Mannan endo-1,4-beta-mannosidase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manC PE=1 SV=1
sp|Q0C8J3|MANC_ASPTN	1.13e-82	21	378	27	400	Probable mannan endo-1,4-beta-mannosidase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=manC PE=3 SV=1
sp|Q5AVP1|MAND_EMENI	6.71e-78	24	381	29	369	Mannan endo-1,4-beta-mannosidase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manD PE=3 SV=1
sp|A1DBV1|MANF_NEOFI	1.95e-77	15	360	107	439	Probable mannan endo-1,4-beta-mannosidase F OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=manF PE=3 SV=1
sp|Q00012|MANA_ASPAC	6.67e-77	17	346	27	339	Mannan endo-1,4-beta-mannosidase A OS=Aspergillus aculeatus OX=5053 GN=manA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000394	0.999581	CS pos: 20-21. Pr: 0.9645

TMHMM  Annotations     

There is no transmembrane helices in PSURA_78803T0-p1.