CAZyme Information: PSURA_78297T0-p1

Basic Information

• Species: Phytophthora ramorum
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora ramorum
• CAZyme ID: PSURA_78297T0-p1
• CAZy Family: GH31
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
787		86621.61	4.3279

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PramorumPr-102	15743	N/A	251	15492

• Gene Location: location=PramPr-102_SC0030:357210-359573(+)

Full Sequence      

MLKSWLAAVVCTALGIAVQHGAPLVSADQWDERTDAIMATFTEDDIIGQMTQIDINQLLT
DDNKIDEDKVRAYAKMRVGSYLTSPFMNGPVNGTYMWTAEEWRERITKIQEITMEENGGH
PMVYGVDSVHGAIFVKGAVLFGQQINGGASFNPDLVYEQGRITGRDTESSGVPWVFGPIL
GISRNPLWARTFETFGEDPYLNSVMGESIIRGLQSNNNTAACMKHWLVYTKTPTGHDKDA
VTVSDYDMLNYFLPPFKAAVDAGVISAMENYISINGVPTVQNTKVMNALLRDDVGFDGMM
VTDYAEIDQLTDFHRTARNATEATRLSLTRASVDMSMVATDTTFYNGTKALLEQSPQFLQ
RLKASARRVVKMKLQLGLYDTPVPGEQNLALIGNDDDVSAALQLARESIVLLQNNDSALP
LAEDASVFLTGFSADNVGRQCGGWTIAWEGYHDHDELLTHGVTVKTGMEQIVGNNSFSFF
NGLYPNGSYSEADLATAKELASKAEYTIAVIGEETYAEKPGDIDDLALPAGQIEYVKELA
STGTKVIVVLFEGRPRLLGEIPETVHAVVNGLLACELGGQAMAEILYGKVNPSGRMPITY
PKQQANIEMPYNHPVTTMCEDAEQNPYYCNMQWDFGTGLSYTNFTYSEVRLSRAVVETPT
EDVVASVDVTNSGSMAGKETVMLFLIQPYRSLNVPEMKQLKKFSKISLEPGQSQTVNFTL
TSDDWSVYYPQIGHGLKKVAEDCDYVVAIKPETDCDVYNETAAANPLCATFTLSTGEYPY
GTFEEPW

Enzyme Prediction     

EC	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	116	338	9.2e-59	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.13e-110	5	749	3	750	beta-glucosidase BglX.
224389	BglX	1.22e-63	42	446	2	373	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	1.50e-48	135	720	108	742	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	7.30e-47	42	369	1	313	Glycosyl hydrolase family 3 N terminal domain.
396478	Glyco_hydro_3_C	4.01e-39	409	641	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29009.1|GH3	0.0	1	773	1	762
UIZ27116.1|GH3	6.68e-288	50	773	1	724
UIZ29613.1|GH3	8.28e-284	1	779	46	825
UIZ29432.1|GH3	2.54e-281	1	779	1	769
CCA27737.1|GH3	1.36e-273	33	773	67	808

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JP0_A	5.81e-126	47	724	30	718	Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus],5JP0_B Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus]
5XXL_A	2.92e-83	26	749	6	737	Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	1.50e-82	26	749	6	737	Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
6R5I_A	3.17e-80	121	734	73	707	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5O_A	1.62e-79	121	734	73	707	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5O_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5R_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q23892|GLUA_DICDI	1.05e-129	31	749	77	811	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2
sp|A7LXU3|BGH3B_BACO1	3.07e-125	12	724	16	740	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
sp|Q56078|BGLX_SALTY	8.53e-82	121	720	105	725	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
sp|P33363|BGLX_ECOLI	8.53e-82	103	720	86	725	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
sp|T2KMH0|PLH24_FORAG	1.55e-72	108	756	49	713	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000328	0.999679	CS pos: 27-28. Pr: 0.9606

TMHMM  Annotations     

There is no transmembrane helices in PSURA_78297T0-p1.