CAZyme Information: PSURA_77648T0-p1

Basic Information

• Species: Phytophthora ramorum
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora ramorum
• CAZyme ID: PSURA_77648T0-p1
• CAZy Family: PL3|PL3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
557	PramPr-102_SC0025|CGC1	63329.35	5.0467

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PramorumPr-102	15743	N/A	251	15492

• Gene Location: location=PramPr-102_SC0025:537693-539366(-)

Full Sequence      

MLLLVVALSLCCCSAETSKTKSKAPATVAPESVVEANEGAFATILYDFGEDSEAQLLGTR
VLMRSIKDSGTKYRRMVIVPQDGLQENSERALKEDDPELEIVRTNIPNVFAHMPITDFRT
QLLHMRNKLVIWDDPQISVLKRVVYLDPENLVLRNLDEIFACHQFCAVDNGQSVVYSNGL
LIISPESIAARNLYSDAIDGFMITGREYNYIGIIQGFMPGLFEAFEESPLFFLGWDGDDN
GEESDGADDGDDAEEPVESSVVHRLPFYYSINHMVFYERMNWDLYKCKDKNLATGEIPGP
LLSYKYSGATLKPWFWLPYTYFQVFWYWQDVRDRLGEDHFSYFMGKVVSFLVIFAFIWFA
YVSLCLKLFTEPNGRPRRLSSWGLPTPGNAQPLSIDVFNSRVVRRACQFSCSVLYAVASM
PLVSSVSIVVMLIWCSVEVIPVTMHPSYAGKLWVITHDLMLTTLLLIFAIAHTLRTAQWK
KDEVPATSELLLGGVWWCIKKLPLLVLAQLQFLYIVGRTDLFQNPVLRPVMTFFFFAIAG
FLEGRILIVEMHRITRG

Enzyme Prediction     

No EC number prediction in PSURA_77648T0-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133018	GT8_Glycogenin	4.42e-16	40	218	2	163	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28025.1|GT8	0.0	45	556	1	514
CCA23792.1|GT8	2.72e-159	16	547	26	572
UIZ21271.1|GT8	2.69e-21	40	352	38	341
CCA16211.1|GT8	6.37e-20	40	374	48	370
QCD81290.1|GT8	4.01e-17	36	334	45	300

PDB Hits     

PSURA_77648T0-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8VZP6|GUX8_ARATH	4.04e-15	37	332	61	313	Putative glucuronosyltransferase PGSIP8 OS=Arabidopsis thaliana OX=3702 GN=PGSIP8 PE=2 SV=1
sp|F4JMI5|GUX7_ARATH	2.19e-14	37	316	57	294	Putative glucuronosyltransferase PGSIP7 OS=Arabidopsis thaliana OX=3702 GN=PGSIP7 PE=3 SV=1
sp|Q8GWB7|GUX6_ARATH	1.20e-11	35	231	27	200	Inositol phosphorylceramide glucuronosyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=IPUT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000692	0.999299	CS pos: 12-13. Pr: 0.7673

TMHMM  Annotations     

Start	End
347	369
411	433
453	472
493	515
530	549