CAZyme Information: PSURA_77401T0-p1

Basic Information

• Species: Phytophthora ramorum
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora ramorum
• CAZyme ID: PSURA_77401T0-p1
• CAZy Family: GH3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
476	PramPr-102_SC0024|CGC1	53155.76	5.2901

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PramorumPr-102	15743	N/A	251	15492

• Gene Location: location=PramPr-102_SC0024:276042-277472(-)

Full Sequence      

MGIFGSCSGLLLGWLLWSCIAHIAALGNDDPLSGFQIDYPQDGGLSTVPLRFKFTMLNNG
SSVDALKARYGDMFICVELEGVSTNCSPVMGAKLRFQELAEGSYVARAYIWDAEMDERYR
ETNPLSFSIVNAADFGAHTDQLVERYRVDQEFPPDLNILQWAEQLKQESLPPQTKSTCPS
GIANDSRSNDVFLVIGVKSAVVTNFARRQAIRETWASKAAQVKVLFLGCTPNLESIPSHR
DRLRLEAAIELEKAVYGDLLTGELECEDSHSFLAEKVASFLGWVVAELPQTQFVMIADDD
IYVRVNFIVKDLTTVMPHKRLYLGELANSLHPRPYAPVRIASDSYYTSKLSYPMEQFVPY
AAGPHFVLSMDCVRFIARNRRHLASLNGQDDTSIALWLLTIQVHVQLTSALISYRFIPCE
DNVLSIADLSPLAIRSIHANLLHNRTLCHGFDRLVWEWKPPGSFMDILDPVSSGAP

Enzyme Prediction     

EC	2.4.1.122:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT31	207	404	1e-33	0.96875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
250845	Galactosyl_T	6.93e-21	206	406	1	193	Galactosyltransferase. This family includes the galactosyltransferases UDP-galactose:2-acetamido-2-deoxy-D-glucose3beta-galactosyltransferase and UDP-Gal:beta-GlcNAc beta 1,3-galactosyltranferase. Specific galactosyltransferases transfer galactose to GlcNAc terminal chains in the synthesis of the lacto-series oligosaccharides types 1 and 2.
215596	PLN03133	8.07e-09	163	382	372	560	beta-1,3-galactosyltransferase; Provisional
178735	PLN03193	1.76e-04	162	403	110	345	beta-1,3-galactosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABR58857.1|GT31|2.4.1.-	1.64e-14	193	451	438	683
AEE84393.1|GT31|2.4.1.-	1.64e-14	193	451	438	683
ARJ31394.1|GT31|2.4.1.-	1.64e-14	193	451	438	683
NP_193838.2|GT31|2.4.1.-	1.74e-14	193	451	495	740
AEE84392.1|GT31|2.4.1.-	1.74e-14	193	451	495	740

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WMM_A	1.62e-13	185	369	103	279	Human poly-N-acetyl-lactosamine synthase structure demonstrates a modular assembly of catalytic subsites for GT-A glycosyltransferases [Homo sapiens],6WMM_B Human poly-N-acetyl-lactosamine synthase structure demonstrates a modular assembly of catalytic subsites for GT-A glycosyltransferases [Homo sapiens]
6WMN_A	1.62e-13	185	369	103	279	Human poly-N-acetyl-lactosamine synthase structure demonstrates a modular assembly of catalytic subsites for GT-A glycosyltransferases [Homo sapiens],6WMN_B Human poly-N-acetyl-lactosamine synthase structure demonstrates a modular assembly of catalytic subsites for GT-A glycosyltransferases [Homo sapiens],6WMN_C Human poly-N-acetyl-lactosamine synthase structure demonstrates a modular assembly of catalytic subsites for GT-A glycosyltransferases [Homo sapiens],6WMN_D Human poly-N-acetyl-lactosamine synthase structure demonstrates a modular assembly of catalytic subsites for GT-A glycosyltransferases [Homo sapiens],6WMO_A Human poly-N-acetyl-lactosamine synthase structure demonstrates a modular assembly of catalytic subsites for GT-A glycosyltransferases [Homo sapiens],6WMO_B Human poly-N-acetyl-lactosamine synthase structure demonstrates a modular assembly of catalytic subsites for GT-A glycosyltransferases [Homo sapiens]
7JHK_A	1.68e-13	185	369	109	285	Chain A, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHK_B Chain B, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHK_C Chain C, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHK_D Chain D, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHL_A Chain A, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHL_B Chain B, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHM_A Chain A, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHM_B Chain B, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHN_A Chain A, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHO_A Chain A, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHO_B Chain B, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens]
7JHI_A	1.83e-13	185	369	123	299	Chain A, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHI_B Chain B, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHI_C Chain C, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHI_D Chain D, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A7XDQ9|B3GTK_ARATH	2.91e-15	193	451	438	683	Hydroxyproline O-galactosyltransferase GALT2 OS=Arabidopsis thaliana OX=3702 GN=GALT2 PE=1 SV=1
sp|Q66H69|B3GN7_RAT	9.88e-15	188	374	127	307	UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 OS=Rattus norvegicus OX=10116 GN=B3gnt7 PE=2 SV=1
sp|Q8K0J2|B3GN7_MOUSE	1.01e-13	188	374	127	307	UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 OS=Mus musculus OX=10090 GN=B3gnt7 PE=2 SV=2
sp|Q91Z92|B3GT6_MOUSE	1.05e-13	192	463	52	315	Beta-1,3-galactosyltransferase 6 OS=Mus musculus OX=10090 GN=B3galt6 PE=2 SV=1
sp|Q9NY97|B3GN2_HUMAN	1.01e-12	185	369	136	312	N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 OS=Homo sapiens OX=9606 GN=B3GNT2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.011329	0.988636	CS pos: 25-26. Pr: 0.9152

TMHMM  Annotations     

There is no transmembrane helices in PSURA_77401T0-p1.