CAZyme Information: PSURA_76972T0-p1

Basic Information

• Species: Phytophthora ramorum
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora ramorum
• CAZyme ID: PSURA_76972T0-p1
• CAZy Family: GH28
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
632		67449.21	3.9926

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PramorumPr-102	15743	N/A	251	15492

• Gene Location: location=PramPr-102_SC0021:370267-372165(-)

Full Sequence      

MYVGNSPIGENAGERTHSNVWRDTSEEEMYGSYLGPGANGDRSSDVPMMRPTMAARPSTA
LHQEIAVGQLDETGAGDAAGKAKTYSGRKVVWPGALFLLLVTAAALSLIAYFGVQQFNSA
QTQQALTEDATEVDSARKSTSVKSCLLPDYLTSDGKIYATDSNTGEKKQIVFTGINWSGM
ENAEGVPHGLATKQSYLDDIAANLSDSGFNAVRLPLNAQMVIDNSAPDTTLFVNSLDTDL
NVDTYIDMIKKVVQGLGKQQIGVLLDIHKIDPNFTDDTSEHLWFTDDYPIATIYKMFETL
ATELCTDLEYNIIGIDLKNEPVGGCWPEDDTDAYCDSDVNWPRAVETIGNKILAICPNWL
IVAEGNYATSTTTEINGENVTYNDWYGASLQNASINPIALDTDGKLVFAPHFYSPSVYPS
SYFFKKQSSSGDTVSVTEYPNTTDGNVLLKAAVTSVLDNAFGNAVTEAGVPTFYGEFGGI
YGSAELLAGLTSTRVIEILIEYANDMNMTGGFAWAINPDGSYDFNDEYKPDDPWQYGLYT
DSSWDAYNTDFATGLQNLKGTGSFPCFSKITTVTSSTSGSSSATITVDSTTSSASSATTT
TTTSTASSAATSSAAAATTTTSTASSSATAAA

Enzyme Prediction     

No EC number prediction in PSURA_76972T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	167	520	8.2e-146	0.997093023255814

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	2.89e-19	150	532	28	376	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	4.85e-19	191	520	24	272	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABL75348.1|GH5_20	0.0	1	575	1	575
ABL75347.1|GH5_20	0.0	1	575	1	574
UIZ24458.1|GH5_20	0.0	1	575	1	571
CCA27479.1|GH5_20	2.77e-193	20	575	20	583
CCA26601.1|GH5_20	4.74e-187	20	568	22	565

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W6M_A	3.58e-33	157	519	15	349	Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
3VVG_A	4.88e-33	157	519	15	349	The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_B The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_C The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3W6L_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
2ZUM_A	1.79e-32	157	519	48	382	Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_A Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_B Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_C Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
3AXX_A	1.79e-32	157	519	48	382	Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_B Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_C Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
3QHO_A	6.04e-32	157	519	48	382	Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHO_B Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHO_C Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P23548|GUN_PAEPO	4.05e-29	168	519	52	355	Endoglucanase OS=Paenibacillus polymyxa OX=1406 PE=3 SV=2
sp|P10474|GUNB_CALSA	1.77e-25	152	424	625	902	Endoglucanase/exoglucanase B OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=celB PE=3 SV=1
sp|P50400|GUND_CELFI	2.58e-22	168	432	59	328	Endoglucanase D OS=Cellulomonas fimi OX=1708 GN=cenD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000031	0.000014

TMHMM  Annotations     

Start	End
90	112