CAZyme Information: PSURA_76907T0-p1

Basic Information

• Species: Phytophthora ramorum
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora ramorum
• CAZyme ID: PSURA_76907T0-p1
• CAZy Family: GH28
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1028	PramPr-102_SC0021|CGC3	116292.32	7.3636

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PramorumPr-102	15743	N/A	251	15492

• Gene Location: location=PramPr-102_SC0021:175489-178575(-)

Full Sequence      

MFGNDKQALMKHEDYELHGTPATGANDGGAGFYPQEGRPMPQQGYVDPRGPVLPPMNVSD
AVGLGGQRDNIISVHGYMHKQGKRTIKGPIHKSWKRRYFALEKAKIYYFHSHLECRQYFT
TRNADLVVGAVELKDALQLRPCARLDLPHKGFEVHTKRRVWVLCPETDEEYRMWFQGVER
AIVANGAGNIIERKLPNVRKYLMKGNQTYRFFYFVFLIAGIVELLALVFWFVIGLEPCDA
SRLEVDCATITSTSLETLRCSSQTFSGWFTPPKWYLQIADVENVTCFRDPPIPQWVSYFA
MLFAEVLTFALGVLYYLGMWKPVRRGAHYFDEFEPPVPDELWPKVDVLLCHYSEPAEETI
DTLMACMNLQYPPHLLQIWVLDDGYCKAKWAKGNPVPTVELNKGILETAGDLRQEVAQFM
YDRVCDPNEDMEVYAWRKLHSSANLPSPSRVKVVNRLDCAVGSFRDDYRYPGLPHVTFIG
RVKPDVHYSKAGNINNCLYNEGANGRYLIILDTDMQPHPKFILATLPFFFDDEDRQDKAK
YICCGIGCNSVAKLCCASCQIAGVPEEQISYCSKDCFENAMHVQSAVHRRQVNGTMSDTR
ASKIDMRCMNCDAKLGKSGVCRKCNPGNKGGDGEDVSSLTTYSDDVRNNAVAFVQTPQYF
RDCIQLQIGDPMGHRNATFYDAIQTGQDGYDCASFAGTNAMFRREALDSIGGIQYGSLTE
DCYTGQVLCAMGWKAQYFRKDFEGEPSERIRLAEGLIPDSVAGSLAQRKRWAKGNFQIAL
MNKKTQYFDPEWKMPEVQVPTYHKSNKFMRRVFYFNSTLYPLGSITAILFYYITIYFLFS
GYAPIYMAGARLVYALVPKLLVQGVLSALSNRTVDNSDVIRSQEVWFAYAFTNCTAVLEA
FWWKITGKEPKWFNTGGASRGSTAELPNVIIFFGTVVGILWSVVRFLAGYNSIQTSHGAS
LLFASLMMGLFIAVKLAPSVRMSIQEYFGWSYESLTDQGNVVGSISIAFGLIFITLWVWI
EQPTSNPF

Enzyme Prediction     

EC	2.4.1.12:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	644	856	3.6e-19	0.8629441624365483

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133043	CESA_CelA_like	1.95e-44	343	779	1	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
236918	bcsA	1.41e-16	651	847	370	548	cellulose synthase catalytic subunit; Provisional
133057	CESA_NdvC_like	4.28e-14	636	781	102	234	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.
404513	Glyco_trans_2_3	3.91e-13	651	849	28	191	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
224136	BcsA	9.16e-13	647	923	164	439	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABP96911.1|GT2	0.0	1	1028	1	1028
ABP96903.1|GT2|2.4.1.12	0.0	1	1028	1	1026
UIZ24309.1|GT2	0.0	10	1028	1	1019
ABP96907.1|GT2	0.0	1	1028	1	1026
ADD84671.1|GT2	0.0	1	1028	1	1026

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EJ1_A	1.26e-15	654	984	260	577	Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	1.37e-15	654	984	272	589	Chain A, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	1.37e-15	654	984	273	590	Chain A, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
7LBY_A	5.10e-14	646	861	378	571	Chain A, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9U720|DCSA_DICDI	1.02e-25	474	778	584	764	Cellulose synthase catalytic subunit A [UDP-forming] OS=Dictyostelium discoideum OX=44689 GN=dcsA PE=1 SV=1
sp|O82859|BCSA2_KOMSB	2.00e-14	646	778	256	382	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter sucrofermentans (strain ATCC 700178 / DSM 15973 / CECT 7291 / JCM 9730 / LMG 18788 / BPR 2001) OX=1307942 GN=bcsA PE=3 SV=1
sp|P19449|BCSA1_KOMXY	2.00e-14	646	778	254	380	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsA PE=1 SV=1
sp|Q9WX61|BCSA3_KOMXY	1.35e-13	646	778	254	380	Cellulose synthase 1 catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsAI PE=3 SV=1
sp|Q93IN2|BCSA_SALTY	1.98e-13	646	861	378	571	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000000

TMHMM  Annotations     

Start	End
211	233
295	317
812	834
849	871
884	906
926	948
961	983
998	1020