CAZyme Information: PSURA_76301T0-p1

Basic Information

• Species: Phytophthora ramorum
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora ramorum
• CAZyme ID: PSURA_76301T0-p1
• CAZy Family: GH17
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
724		78759.70	4.0210

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PramorumPr-102	15743	N/A	251	15492

• Gene Location: location=PramPr-102_SC0017:314292-316466(-)

Full Sequence      

MLSRWSSVVSALSLLTSSVSATTTSYETKSGVLPWVDVDTPTKSKTHKSSRGDTWTLVMS
DEFNHEGRSFEAGEDHLWTAIDKPDGVNAALEIYYPNMTGTACDDDGNCYFYIESDIHET
NLTVWNEYISPPGYEDVTFYYSSGMVQGWNKFCFQGGLVTVRSQLPGAVTNASGNPDIET
GSSSVRAANIDYYPTWPGIWLMGNLGRAIFTGSTARMWPFSYSECNDTIFDSQNQRISAC
DDNPGSGMNANQGRGAPEIDILEGGGTAISSSVQVGPGMPDAFRLIPDNTSAYCIYSYDC
TTEGANNQDVPTEYYWDLRGHKSWYQGLRYAANNLCDVESTDVQSFSTINASVTKGVTVN
ACTMDVCPASYDVNADLGFKDNGTVHWGVNTNGTCFPVQNAYMGAYLCNAGNTASECTES
GGSTSSGSEFTYQMDAISSNWEVHMAAYLDWVTYSLEWVMGDSGYIRWEVEGQVIFEIPS
ESITTPPQNTAQLNPKKLMIEEPMYFIFNVALSSSWGSKPPNAGSSGCYGDGTDNTTNAI
CDAFPMFMKIDYIRVYQDVSASSSMAYGCDPSSHPTKQWIEDNIDDYQDDDNLVVEVSGM
AFCNSDDDCTIATSGSSAVSTGTCNSDGRCECSSDSWTGPRCTETASNEDGDNLYGPPIL
VALIIAAVACVVTFAVILYKVSQAKRTSRMRDQALKMEHAKEIQTGSIDSVDDGAKLVKE
PNFV

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	61	284	7.3e-60	0.6012269938650306

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397841	SKN1	6.44e-56	36	581	98	470	Beta-glucan synthesis-associated protein (SKN1). This family consists of the beta-glucan synthesis-associated proteins KRE6 and SKN1. Beta1,6-Glucan is a key component of the yeast cell wall, interconnecting cell wall proteins, beta1,3-glucan, and chitin. It has been postulated that the synthesis of beta1,6-glucan begins in the endoplasmic reticulum with the formation of protein-bound primer structures and that these primer structures are extended in the Golgi complex by two putative glucosyltransferases that are functionally redundant, Kre6 and Skn1. This is followed by maturation steps at the cell surface and by coupling to other cell wall macromolecules.
185689	GH16_fungal_KRE6_glucanase	1.26e-46	57	557	1	295	Saccharomyces cerevisiae KRE6 and related glucanses, member of glycosyl hydrolase family 16. KRE6 is a Saccharomyces cerevisiae glucanase that participates in the synthesis of beta-1,6-glucan, a major structural component of the cell wall. It is a golgi membrane protein required for normal beta-1,6-glucan levels in the cell wall. KRE6 is closely realted to laminarinase, a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185693	GH16_laminarinase_like	2.40e-11	450	556	159	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185691	GH16_Strep_laminarinase_like	3.69e-04	450	557	173	259	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
185683	Glyco_hydrolase_16	0.001	450	556	143	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ27996.1|GH16	0.0	1	705	1	709
UIZ27810.1|GH16	1.47e-270	26	674	65	728
UIZ28149.1|GH16	4.02e-267	26	669	29	690
UIZ28151.1|GH16	1.15e-266	26	708	30	727
UIZ24235.1|GH16_2	6.28e-259	27	682	30	687

PDB Hits     

PSURA_76301T0-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32486|KRE6_YEAST	7.44e-33	36	602	307	702	Beta-glucan synthesis-associated protein KRE6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KRE6 PE=1 SV=2
sp|P33336|SKN1_YEAST	3.75e-32	36	277	359	574	Beta-glucan synthesis-associated protein SKN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SKN1 PE=1 SV=1
sp|O13941|YEPB_SCHPO	4.62e-30	36	602	219	618	Uncharacterized beta-glucan synthesis-associated protein C23H3.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC23H3.11c PE=3 SV=1
sp|P87023|KRE6_CANAX	7.27e-29	36	602	332	732	Beta-glucan synthesis-associated protein KRE6 OS=Candida albicans OX=5476 GN=KRE6 PE=2 SV=1
sp|P87024|SKN1_CANAX	2.23e-28	36	602	336	729	Beta-glucan synthesis-associated protein SKN1 OS=Candida albicans OX=5476 GN=SKN1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000482	0.999498	CS pos: 21-22. Pr: 0.9735

TMHMM  Annotations     

Start	End
659	681