CAZyme Information: PSURA_75967T0-p1

Basic Information

• Species: Phytophthora ramorum
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora ramorum
• CAZyme ID: PSURA_75967T0-p1
• CAZy Family: GH16
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
432		45044.80	4.1863

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PramorumPr-102	15743	N/A	251	15492

• Gene Location: location=PramPr-102_SC0015:353250-354548(-)

Full Sequence      

MVFGISSARVVVAATLALTIASSMTGIRAEELCSIAPNSYSQAKTDHPELSKALETLEQY
AIASWFTDRMSTDERSSMISSMLSECSEETRLSIVVYGIPNKDCDAGLSSGGTVKSTDDY
KAFLKELTDAVGDRKVLYVVEPDAVGLLAKDGSCGSSAGYLDNLKVAVEALSSNANAELY
VDVGYWMLADSTNAEKIAPIMKELGSCGTVKGVTINTSNYRSTDECATYCTNFQTAMGKS
DMSCIVDTSRNYNGSPTSDWCNVATAGIGKPPTSETGVSNLDYFMWIKPPGESDGECLGG
TAAGSFFAEGFTKLWDLGHFVSEGGMKTIAEGTGDDVTQSSTSAAPSSDSSSYQPSPDQS
TSMPTTAPTTASSSEGQGDPVGTDAPVDSAGTEAPSTTPPATTATPYSATPTETPSPPTV
SSSKCKAKLRSR

Enzyme Prediction     

No EC number prediction in PSURA_75967T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH6	41	297	2.4e-60	0.9455782312925171

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396075	Glyco_hydro_6	5.69e-44	48	297	2	287	Glycosyl hydrolases family 6.
227616	CelA1	3.02e-16	86	309	180	401	Cellulase/cellobiase CelA1 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ23635.1|GH6	2.42e-160	29	348	21	340
UIZ23641.1|GH6	1.31e-89	27	333	23	335
AIG55493.1|GH6	3.00e-83	15	334	4	314
AIG55974.1|GH6	1.12e-81	29	329	22	324
AIG55947.1|GH6	4.07e-81	31	321	18	301

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1TML_A	2.25e-27	65	306	41	274	CRYSTAL STRUCTURE OF THE CATALYTIC DOMAIN OF A THERMOPHILIC ENDOCELLULASE [Thermobifida fusca],2BOD_X Catalytic domain of endo-1,4-glucanase Cel6A from Thermobifida fusca in complex with methyl cellobiosyl-4-thio-beta-cellobioside [Thermobifida fusca]
5JX5_A	1.16e-26	50	314	31	314	GH6 Orpinomyces sp. Y102 enzyme [Orpinomyces sp. Y102],5JX5_B GH6 Orpinomyces sp. Y102 enzyme [Orpinomyces sp. Y102],5JX5_C GH6 Orpinomyces sp. Y102 enzyme [Orpinomyces sp. Y102],5JX5_D GH6 Orpinomyces sp. Y102 enzyme [Orpinomyces sp. Y102],6IDW_A GH6 Orpinomyces sp. Y102 enzyme [Orpinomyces sp. Y102],6IDW_B GH6 Orpinomyces sp. Y102 enzyme [Orpinomyces sp. Y102],6IDW_C GH6 Orpinomyces sp. Y102 enzyme [Orpinomyces sp. Y102],6IDW_D GH6 Orpinomyces sp. Y102 enzyme [Orpinomyces sp. Y102]
1UP0_A	1.79e-26	94	309	73	283	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with cellobiose at 1.75 angstrom [Mycobacterium tuberculosis H37Rv]
1UP3_A	1.79e-26	94	309	73	283	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with METHYL-CELLOBIOSYL-4-DEOXY-4-THIO-BETA-D-CELLOBIOSIDE at 1.6 angstrom [Mycobacterium tuberculosis H37Rv]
1UOZ_A	2.65e-26	94	309	94	304	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with thiocellopentaose at 1.1 angstrom [Mycobacterium tuberculosis H37Rv]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P26414|GUNA_THEBI	4.69e-27	94	295	104	301	Endoglucanase A OS=Thermobispora bispora OX=2006 GN=celA PE=3 SV=1
sp|P26222|GUN2_THEFU	1.20e-25	65	306	72	305	Endoglucanase E-2 OS=Thermobifida fusca OX=2021 GN=celB PE=1 SV=2
sp|P07984|GUNA_CELFI	3.28e-25	45	309	192	438	Endoglucanase A OS=Cellulomonas fimi OX=1708 GN=cenA PE=1 SV=1
sp|Q7SIG5|GUN6_HUMIN	4.85e-23	88	314	77	337	Endoglucanase-6B OS=Humicola insolens OX=34413 GN=cel6B PE=1 SV=1
sp|P13933|GUN1_STRSS	7.69e-23	63	295	113	340	Endoglucanase 1 OS=Streptomyces sp. (strain KSM-9) OX=74575 GN=casA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000419	0.999567	CS pos: 29-30. Pr: 0.9618

TMHMM  Annotations     

There is no transmembrane helices in PSURA_75967T0-p1.