CAZyme Information: PSURA_74498T0-p1

Basic Information

• Species: Phytophthora ramorum
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora ramorum
• CAZyme ID: PSURA_74498T0-p1
• CAZy Family: GH12
• CAZyme Description: Predicted endo-1,3-beta-glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
754	PramPr-102_SC0008|CGC1	83410.48	7.3273

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PramorumPr-102	15743	N/A	251	15492

• Gene Location: location=PramPr-102_SC0008:357016-359280(+)

Full Sequence      

MSIRQISPSCKAPSASRRSVLVLAGLCVQLLFGGDTLVSAQNDSWDPNGKFSPPTLLVNA
TTEQATFCKPRHLDTMRSKPVPTNAWWGNLITCDTTTNATGPIWPNPLAVSVESSGAYGF
ALSYPYRNRFFGGVTDGVAKYYAHPKRNEIQLSACEFATSIPDMQVVNWTDLGVTVQLQA
PASTGTMKSSMVSGMAYFTSTYQGLTPEVLFEAPIATINGVAASIGTRYSGTKFNVVAVS
GQQWWLHVLPSSSSSSTSGIQFNLATSMIMQGLTAFNGTIRISVILDATQSAAQDTYSSC
VVTGGDVEIASDSKYSFKWKTEGDCSNGLLHYALDHHAKSLTAASVAEVANVAMYAATRG
LMKAFVTVSSPPAWNFYESQNIPVTYYPKNRLTKAVALQQDLFTKLRADIQSIWTVSTDG
SYYFTGKLVQQYASLCLMANDPVIVGTDVSLLRRCVTKLESAIAPFLDNSWKYKLKYDAV
AGGVVSSEGFVTGDMNADFGNTVYNDHHYHYGYWVHMASVINFLHPTWKRIGELNNMTRL
LLRDVASPSRDDPYFPKFRGFDWFRGHSYSHGLTTLGDGKDEESTSEDINFAYSMALFGQ
TTNHTRMKDIGRLMTRVSTRSIQTYFLFDSSNTIHPAAFRPRMVPGILFDNKADYATWFS
ADEYMIHGIQMLPVTPLTEYVRTSTFVREEWENILSKLDIVTTDQVSNSWYSLLLLNYAR
LNKAEALSKLSQCTTMMDGLSRSWAIYMAAQYSL

Enzyme Prediction     

No EC number prediction in PSURA_74498T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	77	747	2.5e-169	0.9726688102893891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	2.20e-159	397	746	5	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	1.94e-144	70	750	79	753	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	8.21e-45	78	385	12	313	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ20868.1|GH81	3.33e-240	53	753	90	793
UIZ20872.1|GH81	3.33e-240	53	753	90	793
UIZ20875.1|GH81	3.33e-240	53	753	90	793
UIZ20873.1|GH81	2.68e-239	53	753	90	793
CCA25009.1|GH81	5.37e-238	39	750	60	786

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	3.52e-87	69	750	29	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	5.80e-87	69	750	54	741	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	1.82e-83	69	750	29	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	1.17e-30	81	743	35	647	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	1.74e-21	489	730	423	658	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	1.48e-92	80	750	34	700	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	3.39e-81	187	750	183	735	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q5AIR7|ENG1_CANAL	2.28e-79	52	750	436	1139	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1
sp|P53753|ENG1_YEAST	3.33e-79	80	746	433	1106	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q12168|ENG2_YEAST	1.41e-77	8	753	36	779	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000737	0.999230	CS pos: 40-41. Pr: 0.9527

TMHMM  Annotations     

There is no transmembrane helices in PSURA_74498T0-p1.