CAZyme Information: PSURA_74404T0-p1

Basic Information

• Species: Phytophthora ramorum
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora ramorum
• CAZyme ID: PSURA_74404T0-p1
• CAZy Family: GH12
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
773		86763.80	5.1061

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PramorumPr-102	15743	N/A	251	15492

Full Sequence      

MSPCPQLLCVLCACVAWAAALSPGFNDPMPFYTYPLLEILHPQNDMMLAATELQVEIEIR
EELLSGGLRRSRVCILMQPAFVPPDVTLDKAGSELDESCFDQSLNYTTFHVAGLVPGLSY
AITVGLENGGNMVALSTRTFSVGSILLPGVHGRLSVADALEAGAQLHNAKDRVTAARIYR
YVLEIFPDHAQAQHLLGLALYQDGELRRALPYLYHAVQSNESEENFHNSLGICLKSLGRV
DEAIQHYRRALELNPMQVQAAVNLGDAMQSQGKWEDALQEYSKVAKAPMSLLDSQLEPGK
SENVAKDATGRMCELIRVTDGWYHADRCLNEALERWPDEPLFHNDRGNLLANAGQFETAL
DEYQRSAGLGLLAGKLNLAQTLEALGEMQQSIDLYDRIGPRRLRVGFVSRYMFNPAVGLY
MSELLPQFDRNKYEIIVFAIGQSKSMKVVKQIEAITETLGMDKTTYFLSLARLAPVQAVW
WGNADTSGVPTVDYYLASEHEHNSVSSHYSEIVYRFKGMGIYHKLPDLPKKSIRKDQVRR
AIEERFDIPSDFHFYLAIEVRALILEKDKKAHIFLLSTSSRKIWKGQLQSRMESAGVDPN
RLHFLTDVDQKQESMLMRAADAVVASLHLTRPRASLQAFAAAVPVVTFPNELWASRITYA
FYQQMGINDLIATSLEEYVSLAVKLATDAVFHEKMAQLIKQNRSKLSEDQQAVREWEKFF
DFAGRQVFPSGEKQQGFSTIEWGPIEGLDGTVDWSQVEGVDEIEEVEWNPVEE

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT41	317	720	4.2e-56	0.5319148936170213

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226428	Spy	6.90e-30	152	720	10	611	Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones].
276809	TPR	1.36e-18	190	286	1	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
276809	TPR	6.59e-15	160	252	5	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
411346	social_mot_Tgl	1.81e-12	190	284	31	126	social motility TPR repeat lipoprotein Tgl. Social motility in delta-proteobacterial species such as Myxococcus xanthus depends on a type VI pilus, which in turn depends on assembly of the PilQ secretin complex. Tgl, a tetratricopeptide repeat (TPR) outer membrane lipoprotein, is required for PilQ assembly.
223533	TPR	1.73e-10	183	383	88	277	Tetratricopeptide (TPR) repeat [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ20641.1|GT41	UIZ20641.1|GT41	1.97e-261	20	750	21	932
BAZ61948.1|GT41	BAZ61948.1|GT41	2.04e-41	401	723	533	884
BAZ15802.1|GT41	BAZ15802.1|GT41	2.04e-41	401	723	533	884
QDV15686.1|GT41	QDV15686.1|GT41	1.10e-37	402	729	571	928
QDU48009.1|GT41	QDU48009.1|GT41	5.99e-37	402	729	571	928

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DJS_A	5DJS_A	1.00e-12	329	688	66	478	Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum],5DJS_B Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum],5DJS_C Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum],5DJS_D Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8RVB2|SPY_SOLLC	sp|Q8RVB2|SPY_SOLLC	1.14e-07	397	705	482	825	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Solanum lycopersicum OX=4081 GN=SPY PE=2 SV=1
sp|Q6YZI0|SPY_ORYSJ	sp|Q6YZI0|SPY_ORYSJ	3.41e-07	397	688	468	794	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Oryza sativa subsp. japonica OX=39947 GN=SPY PE=2 SV=1
sp|O82039|SPY_PETHY	sp|O82039|SPY_PETHY	5.89e-07	401	688	486	808	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Petunia hybrida OX=4102 GN=SPY PE=2 SV=1
sp|O82422|SPY_HORVU	sp|O82422|SPY_HORVU	1.34e-06	397	701	468	807	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Hordeum vulgare OX=4513 GN=SPY PE=2 SV=1
sp|Q96301|SPY_ARATH	sp|Q96301|SPY_ARATH	2.29e-06	401	695	481	810	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Arabidopsis thaliana OX=3702 GN=SPY PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000208	0.999782	CS pos: 20-21. Pr: 0.9227

TMHMM  Annotations     

There is no transmembrane helices in PSURA_74404T0-p1.